PDBID: | 8jl7 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the Green fluorescent protein SEA227D variant at pH 8.0 | Authors: | Shin, S.C., Shin, S.C. | Deposition date: | 2023-06-02 | Release date: | 2024-12-01 |
|
PDBID: | 8xsr | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8iky | Status: | HOLD -- hold until a certain date | Title: | The Leeuwenhoekiella ORF-less Group IIC intron DEAR6 at apo state | Authors: | Zhu, H.Z., Liu, J.J.G. | Deposition date: | 2023-03-01 | Release date: | 2024-09-01 |
|
PDBID: | 8xd8 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-12-10 | Release date: | 2024-12-10 |
|
PDBID: | 8is1 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of a polyketide aromatase/cyclase Abx(+)C from Actinomycetes sp. MA7150 | Authors: | Luo, S., Chen, X., Jiang, K., Qu, X. | Deposition date: | 2023-03-20 | Release date: | 2024-09-20 |
|
PDBID: | 8ikt | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-03-01 | Release date: | 2024-09-01 |
|
PDBID: | 8ikv | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-03-01 | Release date: | 2024-09-01 |
|
PDBID: | 9evv | Status: | HOLD -- hold until a certain date | Title: | His579Leu variant of L-arabinonate dehydratase co-crystallized with 2-oxobutyrate | Authors: | Ren, Y., Rouvinen, J., Hakulinen, N. | Deposition date: | 2024-04-02 | Release date: | 2025-04-02 |
|
PDBID: | 8j9u | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-05-04 | Release date: | 2024-10-05 |
|
PDBID: | 8iur | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of a polyketide decarboxylase Abx(+)O from Actinomycetes sp. MA7150 | Authors: | Luo, S., Zhu, C., Jiang, K., Qu, X. | Deposition date: | 2023-03-24 | Release date: | 2024-09-24 |
|
PDBID: | 8ws8 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM mini structure of Cas12-1/crRNA/Target DNA complex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8wrv | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM mini structure of Cas12-2/crRNA/Target DNA complex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8jgk | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of mClC-3 with ADP | Authors: | Wan, Y.Z.Q., Yang, F. | Deposition date: | 2023-05-21 | Release date: | 2024-08-28 |
|
PDBID: | 8wru | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of Cas12-2/crRNA/Target DNA complex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8ibb | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-02-10 | Release date: | 2024-08-20 |
|
PDBID: | 8ik6 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-02-28 | Release date: | 2024-08-31 |
|
PDBID: | 8wmz | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-10-05 | Release date: | 2024-10-05 |
|
PDBID: | 8ikm | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-02-28 | Release date: | 2024-08-31 |
|
PDBID: | 8x3l | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-11-14 | Release date: | 2024-11-14 |
|
PDBID: | 9exe | Status: | HOLD -- hold until a certain date | Title: | membrane complex from Haemophilus influenzae - conformation A | Authors: | Castro, D.K.D.V., Delepelaire, P., Biou, V. | Deposition date: | 2024-04-08 | Release date: | 2025-04-08 |
|
PDBID: | 9exp | Status: | HOLD -- hold until a certain date | Title: | Wzc-K540M-2YE MgADP C8 | Authors: | Liu, J.W., Yang, Y., Naismith, J.H. | Deposition date: | 2024-04-08 | Release date: | 2025-04-08 |
|
PDBID: | 9exq | Status: | HOLD -- hold until a certain date | Title: | Wzc-K540M-3YE-N711Y MgADP C1 | Authors: | Liu, J.W., Yang, Y., Naismith, J.H. | Deposition date: | 2024-04-08 | Release date: | 2025-04-08 |
|
PDBID: | 8xtt | Status: | HOLD -- hold until a certain date | Title: | Nuclear receptor Nor1 ligand binding domain | Authors: | Yoo, J.Y., Yoon, H.S. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 KSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
|
|
PDBID: | 8xto | Status: | HOLD -- hold until a certain date | Title: | Human Keratin 19 head domain segment L18-G38 in solution | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 LGGGSVRFGPGVAFRAPSIHG
|
|
PDBID: | 8xtn | Status: | HOLD -- hold until a certain date | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|