PDBID: | 9c5l | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9c5m | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-06-06 |
|
PDBID: | 9c5n | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9c5o | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9c5p | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9c5r | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9c5t | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-06 |
|
PDBID: | 9c5u | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-06 |
|
PDBID: | 9c5v | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-06 |
|
PDBID: | 9c5w | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-06 |
|
PDBID: | 9c5x | Status: | AUTH -- processed, waiting for author review and approval | Title: | Molecular basis for HerA-Duf supramolecular complex in anti-phage defense - Assembly 3 | Authors: | Rish, A.D., Fu, T.M., Fosuah, E. | Deposition date: | 2024-06-06 |
|
PDBID: | 9c5y | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c5z | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c60 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-07 |
|
PDBID: | 9c62 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-07 |
|
PDBID: | 9c63 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c64 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c65 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 | Sequence: | >Entity 1 STLEVRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
|
|
PDBID: | 9c66 | Status: | HPUB -- hold until publication | Title: | Structure of the Mena EVH1 domain bound to the polyproline segment of PTP1B | Authors: | LaComb, L., Fedorov, E., Bonanno, J.B., Almo, S.C., Ghosh, A. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c67 | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c68 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase Cad1-CARF in the cA6 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c69 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase, Cad1-CARF in the cA4 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6a | Status: | HPUB -- hold until publication | Title: | The CRISPR associated adenosine deaminase Cad1-CARF in the apo form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6b | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6c | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form with ATP (symmetric sites). | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|