| PDBID: | 8v42 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human Vaccinia-related Kinase 1 (VRK1) Bound to ACH000400 | | Authors: | Counago, R.M., de Souza, G.P., Azevedo, A., Guimaraes, C., Mascarello, A., Gama, F., Ferreira, M., Arruda, P. | | Deposition date: | 2023-11-28 | | Sequence: | >Entity 1
SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAAEIEE
|
|
| PDBID: | 8v43 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v4b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR structure of a synthetic analogue of Ramoplanin A2 | | Authors: | Swarbrick, J.D., Marschall, E.A., Cryle, M.J., Tailhades, J. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v4c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4d | | Status: | HPUB -- hold until publication | | Title: | Protein complex | | Authors: | Awad, W., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4e | | Status: | HPUB -- hold until publication | | Title: | Protein complex | | Authors: | Awad, W., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4k | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Campylobacter concisus Csep1 | | Authors: | Anna, R., Xiaotian, Z. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP7 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v50 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP6 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v51 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP10 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v53 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v57 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound cystatin C inhibitor | | Authors: | Pedersen, L.C., Xu, D. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v58 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound heparan sulfate 12mer | | Authors: | Pedersen, L.C., Xu, D., Krahn, J.M. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5b | | Status: | HPUB -- hold until publication | | Title: | Structure of the oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB_Ec F70A/F108Y in complex with FMN | | Authors: | Sharrock, A.V., Ackerley, D.F., Arcus, V. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of MASTL Kinase domain in complex with an inhibitor | | Authors: | Greasley, S.E., Diehl, W. | | Deposition date: | 2023-11-30 |
|
