| PDBID: | 8uei | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-01 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGS(CSO)GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 8uem | | Status: | HPUB -- hold until publication | | Title: | The CryoEM structure of the high affinity Carbon monoxide dehydrogenase from Mycobacterium smegmatis | | Authors: | Grinter, R., Gillett, D. | | Deposition date: | 2023-10-02 |
|
| PDBID: | 8uen | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Corynebacterium ulcerans endo-beta-N-acetylglucosaminidase catalytically inactive CU43 D187A-E189A at 2.3 A (P 21 21 2) | | Authors: | Sastre, D.E., Sultana, N., Sundberg, E.J. | | Deposition date: | 2023-10-02 |
|
| PDBID: | 8uf3 | | Status: | HPUB -- hold until publication | | Title: | Structure of cytochrome c4 from Neisseria gonorrhoeae | | Authors: | Zhong, F., Ragusa, M.J., Pletneva, E.V. | | Deposition date: | 2023-10-03 |
|
| PDBID: | 8uf4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-03 |
|
| PDBID: | 8uf8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-03 |
|
| PDBID: | 8uf9 | | Status: | HPUB -- hold until publication | | Title: | EcDsbA in complex with 2-benzyl-4-phenylthiazole-5-carboxylic acid | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-10-04 |
|
| PDBID: | 8ufd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-04 |
|
| PDBID: | 8ufe | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-04 |
|
| PDBID: | 8uff | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-04 |
|
| PDBID: | 8ufk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-04 |
|
| PDBID: | 8ufv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-04 |
|
| PDBID: | 8ufw | | Status: | HPUB -- hold until publication | | Title: | CA9 mimic with SLC compound | | Authors: | Peat, T.S. | | Deposition date: | 2023-10-04 |
|
| PDBID: | 8ufx | | Status: | HPUB -- hold until publication | | Title: | CAII with SLC compound | | Authors: | Peat, T.S. | | Deposition date: | 2023-10-04 |
|
| PDBID: | 8ufy | | Status: | HPUB -- hold until publication | | Title: | High Resolution structure of A. viridans Lactate Oxidase | | Authors: | Lodowski, D.T. | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8ufz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8ug0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed metal-controlled heterodimer of mutant B1 immunoglobulin-binding domain of Streptococcal Protein G MCHeT_A + MCHeT_B | | Authors: | Mealka, M., Maniaci, B., Stec, B., Huxford, T. | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8ug2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed metal-controlled heterodimer of mutant B1 immunoglobulin-binding domain of Streptococcal Protein G MCHeT_A + MCHeT_C | | Authors: | Mealka, M., Maniaci, B., Stec, B., Huxford, T. | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8ug4 | | Status: | HPUB -- hold until publication | | Title: | Caenorhabditis elegans Otopetrin 8 (CeOtop8) in pH 8.0 | | Authors: | Gan, N., Jiang, Y. | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8ug5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8ug6 | | Status: | HPUB -- hold until publication | | Title: | Mus musculus Otopetrin 2 (mOTOP2) in pH 5.0 | | Authors: | Gan, N., Jiang, Y. | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8ug7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8ug8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8ug9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8uga | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-05 |
|
