| PDBID: | 8qu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 | | Release date: | 2025-04-16 |
|
| PDBID: | 8quf | | Status: | HPUB -- hold until publication | | Title: | carbonic anhydrase XII mimic in complex with 2-(3-((N-(4-sulfamoylbenzyl)pyridine-3-sulfonamido)methyl)phenoxy)acetic acid | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8qun | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with 2-((5-cyano-4-hydroxy-6-(p-tolyl)pyrimidin-2-yl)thio)-N-(4-sulfamoylphenyl)acetamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8quo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8qup | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8qv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 | | Release date: | 2025-04-17 |
|
| PDBID: | 8qv6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 | | Release date: | 2025-04-17 |
|
| PDBID: | 8qvn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cx26 from Gallus Gallus in bicarbonate buffer | | Authors: | Brotherton, D.H., Cameron, A.D. | | Deposition date: | 2023-10-18 | | Sequence: | >Entity 1
MDWGTLQAVLGGVNKHSTSIGKIWLTVLFIFRIMILVVAAERVWGDEQQDFVCNTLQPGCRNVCYDHFFPISHIRLWALQLIFVSTPALLVAMHVAYTRHERKRRFRSGDKINIEELKNEKIHIRGPLWWTYTCSIFFRIVFEAVFMYVFYYMYDGYQMPRLVKCDAWPCPNVVDCFVSRPTEKTTFTIFMLAVSGICMMLNLAELCYLVIKVCLKDSGKTTVLK
|
|
| PDBID: | 8qvp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-02 | | Release date: | 2025-05-02 |
|
| PDBID: | 8qvq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-18 | | Release date: | 2025-04-18 |
|
| PDBID: | 8qvr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-18 | | Release date: | 2025-04-18 |
|
| PDBID: | 8qvt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8qw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8qwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-23 |
|
| PDBID: | 8qwj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of GFP variant | | Authors: | Lenz, M., Fiedler, M., Bellini, D., Chin, J.W. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qx3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8qx4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8qxr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-24 | | Release date: | 2025-04-24 |
|
| PDBID: | 8qy7 | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD apo form | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2025-04-25 |
|
| PDBID: | 8qyc | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD in complex with ATP-gamma-S | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qyd | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
