PDBID: | 8pef | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-13 | Release date: | 2024-12-13 |
|
PDBID: | 8per | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Calf domains of Integrin Alpha5 in complex with angiopoietin2 peptide | Authors: | Murthy, A.V., Sipila, T.J.O., Ponna, S.K., Leppanen, V.M.L., Saharinen, P.I. | Deposition date: | 2023-06-14 | Release date: | 2024-12-14 |
|
PDBID: | 8pes | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-14 | Release date: | 2024-12-14 |
|
PDBID: | 8pet | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-14 | Release date: | 2024-12-14 |
|
PDBID: | 8pf6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-15 | Release date: | 2024-12-15 |
|
PDBID: | 8pf7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-15 | Release date: | 2024-12-15 |
|
PDBID: | 8pfs | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8pg1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-17 | Release date: | 2024-12-17 |
|
PDBID: | 8phc | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-19 | Release date: | 2024-12-19 |
|
PDBID: | 8phh | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of Atkinsonella Hypoxylon Virus-like particles. | Authors: | Byrne, M.J., Sainsbury, F. | Deposition date: | 2023-06-19 |
|
PDBID: | 8phm | Status: | HPUB -- hold until publication | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | Deposition date: | 2023-06-20 | Release date: | 2024-12-20 | Sequence: | >Entity 1 NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8phz | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 | Release date: | 2024-09-20 |
|
PDBID: | 8pie | Status: | HPUB -- hold until publication | Title: | Crystal structure of the human nucleoside diphosphate kinase B domain in complex with the product AT-8500 formed by catalysis of compound AT-9010 | Authors: | Feracci, M., Chazot, A., Ferron, F., Alvarez, K., Canard, B. | Deposition date: | 2023-06-21 | Release date: | 2024-12-26 |
|
PDBID: | 8pik | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8pin | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pio | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pir | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pis | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pj6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-22 | Release date: | 2024-12-22 |
|
PDBID: | 8pk7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-25 | Release date: | 2024-08-25 |
|