PDBID: | 9be1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CG-centric NF-kappaB RelA binding DNA | Authors: | Biswas, T., Shahabi, S., Tsodikov, O.V., Wang, V., Ghosh, G. | Deposition date: | 2024-04-13 |
|
PDBID: | 9be3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-13 |
|
PDBID: | 9be4 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-13 |
|
PDBID: | 9be5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 |
|
PDBID: | 9be6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 |
|
PDBID: | 9be7 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9be8 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9be9 | Status: | HPUB -- hold until publication | Title: | HIV-1 Env 16055 dGly4 NFL | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bea | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | SARS CoV-2 full-length spike protein with internal tag, 2RBD-up conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-04-15 |
|
PDBID: | 9beb | Status: | HPUB -- hold until publication | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight Tungstates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bec | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 9bed | Status: | AUTH -- processed, waiting for author review and approval | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight molybdates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bee | Status: | HPUB -- hold until publication | Title: | alphaB-crystallin N-terminal IXI variant in a fibril state | Authors: | McFarland, R., Reichow, S.L. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bef | Status: | HPUB -- hold until publication | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9beg | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 9beh | Status: | HPUB -- hold until publication | Title: | Structure of GH110A in complex with galactose-6-sulfate | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bej | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 9bek | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 9bel | Status: | HPUB -- hold until publication | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with five Tungstates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bem | Status: | AUTH -- processed, waiting for author review and approval | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with seven Tungstates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 9ben | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-16 |
|
PDBID: | 9beo | Status: | HPUB -- hold until publication | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with 7.5 tungstates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-16 |
|
PDBID: | 9bep | Status: | HPUB -- hold until publication | Title: | Structure of S1_8C, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-16 |
|
PDBID: | 9beq | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-16 |
|
PDBID: | 9ber | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-16 |
|