PDBID: | 8xzk | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzl | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzm | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzn | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzo | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzp | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzr | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzs | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzt | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzu | Status: | HPUB -- hold until publication | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 2.33 angstrom resolution | Authors: | Manjunath, K., Goswami, A. | Deposition date: | 2024-01-21 | Sequence: | >Entity 1 MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
PDBID: | 8xzv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzw | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzx | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzy | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8xzz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8y00 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8y01 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of Medium-wave-sensitive opsin 1 | Authors: | Peng, Q., Jiang, H.H., Cheng, X.Y., Li, J., Zhang, J. | Deposition date: | 2024-01-21 | Release date: | 2025-01-21 |
|
PDBID: | 8y02 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of Short-wave-sensitive opsin 1 | Authors: | Peng, Q., Jiang, H.H., Cheng, X.Y., Li, J., Zhang, J. | Deposition date: | 2024-01-21 | Release date: | 2025-01-21 |
|
PDBID: | 8y03 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y04 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y05 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y06 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y07 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y08 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|