PDBID: | 8wso | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsr | Status: | HPUB -- hold until publication | Title: | the structure of BtSY1_RBD/hACE2 protein | Authors: | Xu, Z.P., Sun, J.Q. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsv | Status: | HPUB -- hold until publication | Title: | Pre-binding structure of HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) in presence of sub optimal concentration of 4-hydroxy benzoic acid | Authors: | Goswami, A., Raju, R., Kasarla, M., Ullah, S. | Deposition date: | 2023-10-17 | Sequence: | >Entity 1 MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
PDBID: | 8wsx | Status: | AUTH -- processed, waiting for author review and approval | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsy | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsz | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wt0 | Status: | HOLD -- hold until a certain date | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wta | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-10-18 |
|
PDBID: | 8wth | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Cas3-HD | Authors: | Mo, X. | Deposition date: | 2023-10-18 |
|
PDBID: | 8wti | Status: | HPUB -- hold until publication | Title: | Crystal structure of the SARS-CoV-2 main protease in complex with 20j | Authors: | Zeng, R., Zhao, X., Yang, S.Y., Lei, J. | Deposition date: | 2023-10-18 |
|
PDBID: | 8wtk | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Cas3-DExD+MG | Authors: | Mo, X. | Deposition date: | 2023-10-18 |
|
PDBID: | 8wtl | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Cas3-DExD+MG+ATP | Authors: | Mo, X. | Deposition date: | 2023-10-18 |
|
PDBID: | 8wtm | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|
PDBID: | 8wtn | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|
PDBID: | 8wto | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|
PDBID: | 8wtp | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|
PDBID: | 8wts | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 3CLpro bound to covalent inhibitor | Authors: | Peng, J., Sun, D., Ding, X. | Deposition date: | 2023-10-19 |
|
PDBID: | 8wtt | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|
PDBID: | 8wtu | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|
PDBID: | 8wtv | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|
PDBID: | 8wtw | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|
PDBID: | 8wtx | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|
PDBID: | 8wty | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|
PDBID: | 8wu0 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of lisargine | Authors: | Wang, P., Zhu, Z. | Deposition date: | 2023-10-19 | Release date: | 2024-10-19 |
|
PDBID: | 8wu9 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human canonical nucleosome | Authors: | Liu, X., Gong, Q.Y. | Deposition date: | 2023-10-20 |
|