| PDBID: | 8vqo | | Status: | HPUB -- hold until publication | | Title: | A novel fold revealed by ex-vivo PrPSc from Elk infected with CWD | | Authors: | Banerjee, V., Wang, F., Baker, M.L., Serysheva, I.I., Soto, C. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8vqp | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure Analysis of EGR1-MIDN | | Authors: | Seo, H.-S., Dhe-Paganon, S. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8vqs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Dehaloperoxidase B in complex with substrate cyclohexene | | Authors: | de Serrano, V.S., Yun, D., Ghiladi, R.A. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8vqt | | Status: | HPUB -- hold until publication | | Title: | Cryatal structure of Dehaloperoxidase B in complex with substrate 1-methyl-cyclohexene | | Authors: | de Serrano, V.S., Yun, D., Ghiladi, R.A. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8vqu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Dehaloperoxidase B in complex with substrate 1,4-cyclohexadiene | | Authors: | de Seerano, V.S., Yun, D., Ghiladi, R.A. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8vqv | | Status: | HPUB -- hold until publication | | Title: | Structure of S. odontolytica ZTP riboswitch bound to m-1-pyridinyl-AICA | | Authors: | Jones, C.P., Ferre D''Amare, A.R. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8vqx | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of SARS-CoV-2 main protease with potent peptide aldehyde inhibitor | | Authors: | Dougan, D.R., Lane, W. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8vr4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8vr8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8vr9 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8vra | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8vrb | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8vrc | | Status: | HPUB -- hold until publication | | Title: | Tetrahymena thermophila MLP1 RRM domain | | Authors: | Donaldson, L.W. | | Deposition date: | 2024-01-21 | | Sequence: | >Entity 1
TFQPIIFSTACEQEGVANWRNITEALLKQHNVHAPYCRFGKLEGNFALNKDKTSQEVIDQLVQDGLQFGESKVTIKVSEGEALSKFWELHGRHYNGVMEL
|
|
| PDBID: | 8vrf | | Status: | HPUB -- hold until publication | | Title: | Sucrose-phosphate synthase-like protein from Leishmania major | | Authors: | Gorman, M.A., Parker, M.W., McConville, M.J. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8vrl | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium smegmatis 50S ribosomal subunit bound to HflX and chloramphenicol:50S-HflX-A-Clm | | Authors: | Majumdar, S., Koripella, R.K., Sharma, M.R., Manjari, S.R., Banavali, N.K., Agrawal, R.K. | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vro | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vrp | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor | | Authors: | Goldstone, D.C., Walsham, L. | | Deposition date: | 2024-01-22 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 8vrq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vrt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vry | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vs0 | | Status: | HPUB -- hold until publication | | Title: | A structural study of selectivity mechanisms for JNK3 and p38 alpha with indazole scaffold probing compounds | | Authors: | Park, H., Feng, Y. | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vs1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vs2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vs3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
