PDBID: | 8trv | Status: | HPUB -- hold until publication | Title: | Structure of the EphA2 LBDCRD bound to FabS1C_C1 | Authors: | Singer, A.U., Bruce, H.A., Blazer, L., Adams, J.J., Sicheri, F., Sidhu, S.S. | Deposition date: | 2023-08-10 |
|
PDBID: | 8trw | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 | Release date: | 2025-02-10 |
|
PDBID: | 8trx | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8trz | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-10 | Release date: | 2024-08-10 |
|
PDBID: | 8ts1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8ts2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8ts3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8tse | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-11 |
|
PDBID: | 8tsk | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-11 | Release date: | 2025-02-11 |
|
PDBID: | 8tsm | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-11 | Release date: | 2024-08-11 |
|
PDBID: | 8tt8 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 |
|
PDBID: | 8tt9 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 | Sequence: | >Entity 1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
PDBID: | 8tta | Status: | HOLD -- hold until a certain date | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 21 (1328-1341) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ttc | Status: | HOLD -- hold until a certain date | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 20 (1289-1302) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ttd | Status: | HOLD -- hold until a certain date | Title: | Structure of VPS29 complexed with Fam21A repeat 21 (1328-1341) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ttq | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-14 |
|
PDBID: | 8ttr | Status: | HPUB -- hold until publication | Title: | CA9 mimic bound to SH7 | Authors: | Peat, T.S. | Deposition date: | 2023-08-14 |
|
PDBID: | 8tts | Status: | HPUB -- hold until publication | Title: | OXA-48 in complex with CDD-2201 | Authors: | Park, S., Su, L., Taylor, D., Sun, Z., Ramana, S., Chamakuri, S., Qin, X., Tan, Z., Sharma, K., Li, F., Fan, J., Hu, L., Sankaran, B., Prasad, B.V.V., Matzuk, M., Palzkill, T. | Deposition date: | 2023-08-15 |
|
PDBID: | 8ttt | Status: | HOLD -- hold until a certain date | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 15 (1124-1140) | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | Deposition date: | 2023-08-15 | Release date: | 2024-08-15 |
|
PDBID: | 8ttu | Status: | HOLD -- hold until a certain date | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 19 (1261 - 1274) | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | Deposition date: | 2023-08-15 | Release date: | 2024-08-15 |
|
PDBID: | 8ttv | Status: | HOLD -- hold until a certain date | Title: | Structure of SNX27 FERM complexed with Fam21A repeat 20 (1289-1302) | Authors: | Guo, Q., Chen, K.-E., Collins, B.M. | Deposition date: | 2023-08-15 | Release date: | 2024-08-15 |
|
PDBID: | 8ttx | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-15 | Release date: | 2024-08-15 |
|
PDBID: | 8tu7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-15 |
|
PDBID: | 8tu8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-15 |
|
PDBID: | 8tue | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-16 |
|