PDBID: | 8tr8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8tra | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8trb | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8trf | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2025-02-09 |
|
PDBID: | 8trh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 | Release date: | 2025-02-05 |
|
PDBID: | 8tri | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8trj | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8trk | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8trp | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-10 | Release date: | 2024-08-10 |
|
PDBID: | 8tru | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8trw | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 | Release date: | 2025-02-10 |
|
PDBID: | 8trx | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8trz | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-10 | Release date: | 2025-02-09 |
|
PDBID: | 8ts1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8ts2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8ts3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8tse | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-11 |
|
PDBID: | 8tsk | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-11 | Release date: | 2025-02-11 |
|
PDBID: | 8tsm | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-11 | Release date: | 2024-08-11 |
|
PDBID: | 8tt8 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 |
|
PDBID: | 8tt9 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 | Sequence: | >Entity 1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
PDBID: | 8tta | Status: | HOLD -- hold until a certain date | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 21 (1328-1341) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ttc | Status: | HOLD -- hold until a certain date | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 20 (1289-1302) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ttd | Status: | HOLD -- hold until a certain date | Title: | Structure of VPS29 complexed with Fam21A repeat 21 (1328-1341) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ttq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-14 | Release date: | 2024-12-31 |
|