| PDBID: | 8x8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of lipoxygenase from Enhygromyxa salina | | Authors: | Kim, J.W., Seo, P.W., Kim, J.S. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8h | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-27 | | Release date: | 2024-11-27 |
|
| PDBID: | 8x8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7z | | Status: | HPUB -- hold until publication | | Title: | transcription factor BARHL2 homodimer with spacing four bp | | Authors: | Morgunova, E., Popov, A., Yin, Y., Taipale, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r82 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r81 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7x | | Status: | HPUB -- hold until publication | | Title: | Kras G12D in complex with compound 4 | | Authors: | Kessler, D., Zak, K.M. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7v | | Status: | HPUB -- hold until publication | | Title: | MutSbeta bound to compound CHDI-00898647 in the canonical DNA-mismatch bound form | | Authors: | Haque, T., Brace, G., Felsenfeld, D., Tilack, K., Schaertl, S., Ballantyne, G., Maillard, M., Iyer, R., Prasad, B., Thomsen, M., Wilkionson, H., Plotnikov, N., Ritzefeld, M. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v36 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v37 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v39 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v3g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v35 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x89 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Streptococcus pneumoniae fabG | | Authors: | Xu, K.M. | | Deposition date: | 2023-11-27 | | Sequence: | >Entity 1
MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELLAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTVFLAGQDYLTGQVIAIDGGLSM
|
|
| PDBID: | 8x8m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
