PDBID: | 9f6j | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human DNA Polymerase epsilon bound to T-C mismatched DNA (Polymerase Arrest state) | Authors: | Roske, J.J., Yeeles, J.T.P. | Deposition date: | 2024-05-01 |
|
PDBID: | 9f6i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human DNA Polymerase epsilon bound to T-C mismatched DNA (Post-Insertion state) | Authors: | Roske, J.J., Yeeles, J.T.P. | Deposition date: | 2024-05-01 |
|
PDBID: | 9f6h | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of bovine alpha-chymotrypsin in complex with the bicyclic peptide inhibitor CP6.4.3 | Authors: | Vascon, F., Mazzocato, Y., Trevisan, L., Linciano, S., Romanyuk, Z., Angelini, A., Cendron, L. | Deposition date: | 2024-05-01 |
|
PDBID: | 9f6g | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-01 |
|
PDBID: | 9f6f | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-01 |
|
PDBID: | 9f6e | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human DNA polymerase epsilon bound to DNA and PCNA (ajar conformation) | Authors: | Roske, J.J., Yeeles, J.T.P. | Deposition date: | 2024-05-01 |
|
PDBID: | 9f6d | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-01 |
|
PDBID: | 9f6c | Status: | HPUB -- hold until publication | Title: | Cardiac myosin motor domain in the pre-powerstroke state co-crystallized with the inhibitor aficamten | Authors: | Robert-Paganin, J., Hartman, J.J., Morgan, B.P., Malik, F.I., Houdusse, A. | Deposition date: | 2024-05-01 |
|
PDBID: | 9f6b | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human neuropilin-1 in a complex with a quinoline based antagonists | Authors: | Djordjevic, S., Selwood, D., Hubbard, P., Leonard, P., Mota, F. | Deposition date: | 2024-04-30 |
|
PDBID: | 9f6a | Status: | AUTH -- processed, waiting for author review and approval | Title: | EVA71 E096A native particle | Authors: | Kingston, N.J., Stonehouse, N.J., Rowlands, D.J., Hogle, J.M., Filman, D.J., Snowden, J.S.S. | Deposition date: | 2024-04-30 |
|
PDBID: | 9f69 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 | Sequence: | >Entity 1 RKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
|
|
PDBID: | 9f68 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human Interleukin-31 in complex with Oncostatin-M receptor | Authors: | Bloch, Y., Savvides, S.N. | Deposition date: | 2024-04-30 | Release date: | 2025-04-30 |
|
PDBID: | 9f67 | Status: | PROC -- to be processed | Deposition date: | 2024-04-30 |
|
PDBID: | 9f66 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Heme-Oxygenase from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) flash-cooled under CO2 pressure | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | Deposition date: | 2024-04-30 |
|
PDBID: | 9f65 | Status: | HPUB -- hold until publication | Title: | Crystal structure of thiol peroxidase mutant (C94A) in complex with Metro-P3* (H. pylori) | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | Deposition date: | 2024-04-30 | Sequence: | >Entity 1 MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
PDBID: | 9f64 | Status: | HPUB -- hold until publication | Title: | Crystal structure of thiol peroxidase mutant (C94A) in complex with Metro* (H. pylori | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | Deposition date: | 2024-04-30 | Sequence: | >Entity 1 MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
PDBID: | 9f62 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 9f61 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 9f60 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5z | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5y | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5x | Status: | PROC -- to be processed | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5w | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5v | Status: | HPUB -- hold until publication | Title: | Crystal structure of thiol peroxidase from Helicobacter pylori (HpTx, reduced) | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | Deposition date: | 2024-04-30 | Sequence: | >Entity 1 MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
PDBID: | 9f5u | Status: | HPUB -- hold until publication | Title: | Crystal structure of Heme-Oxygenase from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | Deposition date: | 2024-04-30 |
|