| PDBID: | 9euj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eui | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9euh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eug | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9euf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eue | | Status: | HPUB -- hold until publication | | Title: | The FK1 domain of FKBP51 in complex with SAFit-analog 23a | | Authors: | Meyners, C., Buffa, V., Hausch, F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eud | | Status: | HPUB -- hold until publication | | Title: | The FK1 domain of FKBP51 in complex with SAFit-analog 23c | | Authors: | Meyners, C., Buffa, V., Hausch, F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9euc | | Status: | HPUB -- hold until publication | | Title: | The FK1 domain of FKBP51 in complex with SAFit-analog 23b | | Authors: | Meyners, C., Buffa, V., Hausch, F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eub | | Status: | HPUB -- hold until publication | | Title: | The FK1 domain of FKBP51 in complex with SAFit-analog 24e | | Authors: | Meyners, C., Buffa, V., Hausch, F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eua | | Status: | HPUB -- hold until publication | | Title: | The FK1 domain of FKBP51 in complex with SAFit-analog 23d | | Authors: | Meyners, C., Buffa, V., Hausch, F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eu9 | | Status: | HPUB -- hold until publication | | Title: | The FK1 domain of FKBP51 in complex with SAFit-analog 15i | | Authors: | Meyners, C., Buffa, V., Hausch, F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eu8 | | Status: | HPUB -- hold until publication | | Title: | The FK1 domain of FKBP51 in complex with SAFit-analog 15h | | Authors: | Meyners, C., Buffa, V., Hausch, F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eu7 | | Status: | HPUB -- hold until publication | | Title: | The FK1 domain of FKBP51 in complex with SAFit-analog 15b | | Authors: | Meyners, C., Buffa, V., Hausch, F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eu6 | | Status: | HPUB -- hold until publication | | Title: | The FK1 domain of FKBP51 in complex with SAFit-analog 23j | | Authors: | Meyners, C., Buffa, V., Hausch, F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eu5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SSX structure of Autotaxin at room temperature | | Authors: | Eymery, M.C., McCarthy, A.A., Foos, N., Basu, S. | | Deposition date: | 2024-03-27 | | Release date: | 2025-03-27 |
|
| PDBID: | 9eu4 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MQQKYQPTEANLKARSEFQDNKFGIFLHWGLYAMLATGEWTMTNNNLNYKEYAKLAGGFYPSKFDADKWVAAIKASGAKYICFTTRHHEGFSMFDTKYSDYNIVKATPFKRDVVKELADACAKHGIKLHFYYSHIDWYREDAPQGRTGRRTGRPNPKGDWKSYYQFMNNQLTELLTNYGPIGAIWFDGWWDQDINPDFDWELPEQYALIHRLQPACLVGNNHHQTPFAGEDIQIFERDLPGENTAGLSGQSVSHLPLETCETMNGMWGYKITDQNYKSTKTLIHYLVKAAGKDANLLMNIGPQPDGELPEVAVQRLKEVGEWMSKYGETIYGTRGGLVAPHDWGVTTQKGNKLYVHILNLQDKALFLPIVDKKVKKAVVFADKTPVRFTKNKEGIVLELAKVPTDVDYVVELTIDDEHHHHHH
|
|
| PDBID: | 9eu3 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MPAQPGYTPSADNLKARETFQDDKFGIFIHWGIYSMLADGEWVMHNKNLNWEEYAKLASGFYPAKFNAAEWVAAIKASGAKYITITSRHHDGFSMYATQQSDYNIVDATPFKRDVIHELADECRKQGIRLHLYYSHLDWRRDDYYPLGRTGKGTGRTTQGKWEDYCAFMNNQLTELLTNYGLIGAIWFDGMWDKDIYPDGMTAKTWNLNEQYTLIHRLQPACLIGNNHHITPFAGEDIQIFERDLPGENKAGLSGQDISRLPLETCETMNGMWGYKITDQDYKSTKILIQYLVKAAGKNANLLMNVGPQPNGELPTVAVQRLREMGEWMKIYAPTIQGTRGGVVTPRDWGVTTQKGKTLYVHVLNLDDKALFLPYAGNKLKSAVEYQSRKSVRFIQDRDGILLKFTDKPHSPDYVLELTFANELPLNLEHHHHHH
|
|
| PDBID: | 9eu2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eu1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eu0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9etz | | Status: | HPUB -- hold until publication | | Title: | III2IV respiratory supercomplex from Saccharomyces cerevisiae | | Authors: | Moe, A., Brzezinski, P. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9ety | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9etx | | Status: | HPUB -- hold until publication | | Title: | KEAP1 BTB in complex with compound 23 | | Authors: | Richardson, W., Bullock, A.N., Rothweiler, E.M., Manning, C.E., Sweeney, M.N., Chalk, R., Huber, K.V.M. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9etw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9etv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
