| PDBID: | 9jfv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jft | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfr | | Status: | PROC -- to be processed | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Resembled the partial R-loop state with the PAM-distal spacer forming a base-pair interaction with the TS | | Authors: | Zhang, S., Liu, J. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Areconstituted LaTraC ternary complex with a full R-loop | | Authors: | Zhang, S., Liu, J. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Areconstituted LaTraC ternary complex with a full R-loop | | Authors: | Zhang, S., Liu, J. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfn | | Status: | HPUB -- hold until publication | | Title: | Arginine decarboxylase in Aspergillus oryzae complexed with agmatine | | Authors: | Mikami, B., Yaukawa, K., Fujiwara, S., Takita, T., Mizutani, K., Odagaki, Y., Murakami, Y. | | Deposition date: | 2024-09-05 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMQSVRIIPTYIERAPGAPATGSSLHSHGHWMPENVELRRAWLSSLLDKTKAEIPRKLRDNVENPVETFRKLIENDSTLYMLAHSMFDEVPEKAPYDRDPTTLKKQVRNYKTMLYLFNTLLTEVPEYFLRDNPNVPSGLIGFPFNIIVDWPMGTPSGRQFFLDTRVNKCLKDILNKWNEFLKDPTAQGNGNKGGNQALIDAGWSSDAAVEQLVNKANESTTDKKKTFSEIFQHPANGTQENFFNYACWDNFFTRRFKDGVRPVADAAVVNACESFPLSFDTDVSRRNTFWLKGTPYSLHDMLGATQDERVASYVDGFVGGSVYQAFLSADSYHCWNAPVTGKVVYRSLIDGTYFAETAAAGFGGSNGPDPAGPDVSQRYITHIAARGVLIVDTNVTGGAKIGLVGFVPVGMSEVSTCDWFDNTEEGKTISKGDVIGAFHSGGS
>Entity 2
THCLIFQRDAVKKLQFIPKAQYPEIATTNLAVNSELAKLTS
|
|
| PDBID: | 9jfm | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of sal87-DndI | | Authors: | Dan, W. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfk | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Wild-type structure of catalytic domains from threonine deaminase in complex with PLP | | Authors: | Khodi, S. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Protomer Complex (Double ring, conformer 2) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jff | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Protomer Complex (Double ring, Confomer 1) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human insulin receptor bound with A62-dimer, Pseudo-gamma conformation | | Authors: | Kim, J., Na, H., Yunn, N., Ryu, S., Cho, Y. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pseudomonas aeruginosa SuhB complexed with Gallic acid in monoclinic space group | | Authors: | Yadav, V.K., Shukla, M., Maji, S., Bhattacharyya, S. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Protomer Complex (Single Ring, conformer 2) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jf9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human insulin receptor bound with A62-dimer, Pseudo-arrowhead conformation | | Authors: | Kim, J., Na, J., Yunn, N., Ryu, S., Cho, Y. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jf8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jf7 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-09-04 |
|
