| PDBID: | 8rwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8rwf | | Status: | HPUB -- hold until publication | | Title: | Domains 1 and 2 of Bacillus anthracis Sap S-layer in complex with Nb692 | | Authors: | Sogues, A., Remaut, H. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8rwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8rwd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8rwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 | | Sequence: | >Entity 1
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSDINSSGTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCATEGKYGRTWYGQLEYHYWGQGTQVTVSEHHHHHH
>Entity 2
MHHHHHHESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTYTVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGEITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAE
|
|
| PDBID: | 8rw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the adenosine A2A receptor in complex with Istradefylline | | Authors: | Glover, H. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 8rvu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) in the presence of sulfate | | Authors: | Sterckx, Y.G.-J. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8rvp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8rvo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8rvn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
