PDBID: | 8qsb | Status: | AUTH -- processed, waiting for author review and approval | Title: | Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 86 (1124384). | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qsa | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 86 (1084384) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs9 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 83 (1084383) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs8 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 78 (1084378) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs7 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 70 (1084352) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs6 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs5 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs4 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 22 (1083853) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs3 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 23 (1083848) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qs2 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 29 (1076409) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-10-10 |
|
PDBID: | 8qrz | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-09 |
|
PDBID: | 8qrw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-09 |
|
PDBID: | 8qrv | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-09 |
|
PDBID: | 8qru | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-09 |
|
PDBID: | 8qrs | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-09 |
|
PDBID: | 8qrr | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-09 |
|
PDBID: | 8qrq | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-09 |
|
PDBID: | 8qrp | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-09 |
|
PDBID: | 8qro | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-09 |
|
PDBID: | 8qrj | Status: | HPUB -- hold until publication | Title: | LCC-ICCG PETase mutant H218Y | Authors: | Orr, G., Niv, Y., Barakat, M., Boginya, A., Dessau, M., Afriat-Jurnou, L. | Deposition date: | 2023-10-09 | Sequence: | >Entity 1 MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQYAIPFYQNLPSTTPKVYVELCNASHIAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ
|
|
PDBID: | 8qri | Status: | HPUB -- hold until publication | Title: | TRRAP and EP400 in the human Tip60 complex | Authors: | Li, C., Smirnova, E., Schnitzler, C., Crucifix, C., Concordet, J.P., Brion, A., Poterszman, A., SChultz, P., Papai, G., Ben-Shem, A. | Deposition date: | 2023-10-09 |
|
PDBID: | 8qrc | Status: | HPUB -- hold until publication | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | Authors: | Gelin, M., Labesse, G. | Deposition date: | 2023-10-06 |
|
PDBID: | 8qrb | Status: | HPUB -- hold until publication | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | Authors: | Gelin, M., Labesse, G. | Deposition date: | 2023-10-06 |
|
PDBID: | 8qra | Status: | HPUB -- hold until publication | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | Authors: | Gelin, M., Labesse, G. | Deposition date: | 2023-10-06 |
|
PDBID: | 8qr9 | Status: | HPUB -- hold until publication | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | Authors: | Gelin, M., Labesse, G. | Deposition date: | 2023-10-06 |
|