| PDBID: | 9g2j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Thaumatin structure determined using SoS chip at ID29 (serial crystallography) | | Authors: | Doak, R.B., Shoeman, R.L., Gorel, A., Barends, T.R.M., Schlichting, I. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9g2i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 25-phosphosteroid lyase + phosphate | | Authors: | Ermler, U., Boll, M., Demmer, U., Jacoby, C. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9g2h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g2f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g2e | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g2d | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g2c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g2b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g29 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g28 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g27 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g26 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g25 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g24 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g23 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g22 | | Status: | HPUB -- hold until publication | | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bDR) at 277K | | Authors: | Horvath, D. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g21 | | Status: | HPUB -- hold until publication | | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 321K | | Authors: | Horvath, D. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g20 | | Status: | HPUB -- hold until publication | | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 310K | | Authors: | Horvath, D. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1t | | Status: | HPUB -- hold until publication | | Title: | Human LTC4 synthase in complex with compound 5 | | Authors: | Srinivas, H. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
