PDBID: | 8s00 | Status: | HPUB -- hold until publication | Title: | CpKRS complexed with lysine and an inhibitor | Authors: | Dawson, A., Baragana, B., Caldwell, N. | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzz | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 | Sequence: | >Entity 1 MDLAKLGLKEVMPTKINLEGLVGDHAFSMEGVGEGNILEGTQEVKISVTKGAPLPFAFDIVSVAF(CRO)NRAYTGYPEEISDYFLQSFPEGFTYERNIRYQDGGTAIVKSDISLEDGKFIVNVDFKAKDLRRMGPVMQQDIVGMQPSYESMYTNVTSVIGECIIAFKLQTGKHFTYHMRTVYKSKKPVETMPLYHFIQHRLVKTNVDTASGYVVQHETAIAAHSTIKKIEGSLP
>Entity 2 MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQSGLEVLFQ
|
|
PDBID: | 8rzx | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzu | Status: | HPUB -- hold until publication | Title: | Structure of human SETD2 L1609P mutant in complex with SAM and H3K36M peptide | Authors: | Mechaly, A.E., Michail, C., Haouz, A., Rodrigues-Lima, F. | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzt | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzs | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzr | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8rzq | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8rzp | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8rzo | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8rzn | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8rzm | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8rzk | Status: | HPUB -- hold until publication | Title: | The Michaelis complex of ZgGH129 D486N from Zobellia galactanivorans with neo-b/k-oligo-carrageenan tetrasaccharide (beta-kappa neo-oligo-carrageenan DP4). | Authors: | Roret, T., Czjzek, M., Ficko-Blean, E. | Deposition date: | 2024-02-12 |
|
PDBID: | 8rzj | Status: | HPUB -- hold until publication | Title: | ZgGH129 from Zobellia galactanivorans in complex with the inhibitor ADG-IF (3,6-anhydro-D-galacto-isofagomine). | Authors: | Roret, T., Czjzek, M., Ficko-Blean, E. | Deposition date: | 2024-02-12 |
|
PDBID: | 8rzi | Status: | HPUB -- hold until publication | Title: | ZgGH129 from Zobellia galactanivorans soaked with 1,2-diF-ADG (3,6-Anhydro-2-deoxy-2-fluoro-a-D-galactopyranosyl fluoride) resulting in a trapped glycosyl-enzyme intermediate. | Authors: | Roret, T., Czjzek, M., Ficko-Blean, E. | Deposition date: | 2024-02-12 |
|
PDBID: | 8rzh | Status: | HPUB -- hold until publication | Title: | ZgGH129 from Zobellia galactanivorans in complex with the inhibitor AD-DGJ (3,6-anhydro-D-1-deoxygalactonojirimycin). | Authors: | Roret, T., Czjzek, M., Ficko-Blean, E. | Deposition date: | 2024-02-12 |
|
PDBID: | 8rzg | Status: | HPUB -- hold until publication | Title: | ZgGH129 from Zobellia galactanivorans soaked with the product of the reaction ADG (3,6-anhydro-D-galactose). | Authors: | Roret, T., Czjzek, M., Ficko-Blean, E. | Deposition date: | 2024-02-12 |
|
PDBID: | 8rzf | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8rza | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8rz9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8rz8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8rz7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8rz5 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Crystal structure of D-amino acid transaminase from Haliscomenobacter hydrossis (apo form) after 30 sec of soaking with phenilhydrazine | Authors: | Matyuta, I.O., Bakunova, A.K., Bezsudnova, E.Y., Popov, V.O., Boyko, K.M. | Deposition date: | 2024-02-12 |
|
PDBID: | 8rz4 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Crystal structure of D-amino acid transaminase from Haliscomenobacter hydrossis (holo form) after 5 sec of soaking with phenilhydrazine | Authors: | Matyuta, I.O., Bakunova, A.K., Bezsudnova, E.Y., Popov, V.O., Boyko, K.M. | Deposition date: | 2024-02-12 |
|
PDBID: | 8rz3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|