| PDBID: | 8vcl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide | | Authors: | Ma, J., Baker, B.M. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vck | | Status: | HPUB -- hold until publication | | Title: | Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1) | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8vc9 | | Status: | HPUB -- hold until publication | | Title: | Hybrid response regulator LvrB from Leptospira / phosphorylated REC form | | Authors: | Mechaly, A., Buschiazzo, A. | | Deposition date: | 2023-12-13 | | Sequence: | >Entity 1
MNKWKFLFLEDSLVDLELIQRQLNRAKIDYYPIHVSDSEGFSQAILDQKPHLILSDFSLPKYDGFSALKLAKKICPTTPFIFVSGTYGEEAAIQTLTMGATDYVLKDRIEKLLPAVQRALHELEDHELRIKAEKERYELEEQLRQSQKLEAMGVMAGTMAHEINNPLIAISEYAAMIAKGEVDSEKAKQLASKIRDESARISTIMKNLLRFSRDDKGSLYPVEVGEILVKLESITQQIFKMNRIDASWKNVEPGHSIQCREGQILQILLNLVNNAVDSLNQKYPEYDTEKRIILENSIVEENHKKYAEFSIQDFGTGIPIDIQKSIFKTFFTTKSADKGTGLGLSVSLGIAKEHGGSLNFESEPGRYTRFYLRVPIFDPSVQ
|
|
| PDBID: | 8vc7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8vc0 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 CA crosslinked pentamer in complex with GS-CA1 | | Authors: | Piacentini, J., Ganser-Pornillos, B.K., Pornillos, O. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8vbx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbi | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbh | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbg | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbf | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbe | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vbd | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
