PDBID: | 8ubt | Status: | HPUB -- hold until publication | Title: | Structure of SCF-FBXL17-BACH1BTB E3 ligase complex | Authors: | Shi, H., Cao, S. | Deposition date: | 2023-09-24 |
|
PDBID: | 8ubs | Status: | HPUB -- hold until publication | Title: | Crystal structure of NrdJ-1 split intein fusion | Authors: | Kofoed, C., Ye, X., Jeffrey, P.D., Muir, T.W. | Deposition date: | 2023-09-24 |
|
PDBID: | 8ubq | Status: | HPUB -- hold until publication | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and 2-benzyl-4-phenylthiazole-5-carboxylic acid | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-24 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8ubp | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubo | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubn | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubm | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubl | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubk | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubj | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubi | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-23 |
|
PDBID: | 8ubf | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8ube | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8ubd | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8ubc | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8ubb | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8uba | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8ub9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8ub8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8ub7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-22 |
|
PDBID: | 8ub5 | Status: | HPUB -- hold until publication | Title: | The Apo NanH structure from Clostridium perfringens | Authors: | Medley, B.J., Boraston, A.B. | Deposition date: | 2023-09-22 |
|
PDBID: | 8ub4 | Status: | PROC -- to be processed | Title: | Substrate-bound Cdc48, Consensus | Authors: | Cooney, I., Schubert, H.L., Cedeno, K., Lin, H.J.L., Fisher, O.N., Price, J.C., Hill, C.P., Shen, P.S. | Deposition date: | 2023-09-22 |
|
PDBID: | 8ub2 | Status: | HPUB -- hold until publication | Title: | Structure of Adenosine monophosphate/RNase A | Authors: | Pallan, P.S., Egli, M. | Deposition date: | 2023-09-22 |
|
PDBID: | 8ub1 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Structure of Butyl-5''-O-adenosine phosphoramidate/RNase A | Authors: | Pallan, P.S., Egli, M. | Deposition date: | 2023-09-22 |
|
PDBID: | 8ub0 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Structure of Histidine-5''-O-adenosine phosphoramidate/RNase A | Authors: | Pallan, P.S., Egli, M. | Deposition date: | 2023-09-22 |
|