PDBID: | 8wsx | Status: | AUTH -- processed, waiting for author review and approval | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsv | Status: | HPUB -- hold until publication | Title: | Pre-binding structure of HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) in presence of sub optimal concentration of 4-hydroxy benzoic acid | Authors: | Goswami, A., Raju, R., Kasarla, M., Ullah, S. | Deposition date: | 2023-10-17 | Sequence: | >Entity 1 MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
PDBID: | 8wsr | Status: | HPUB -- hold until publication | Title: | the structure of BtSY1_RBD/hACE2 protein | Authors: | Xu, Z.P., Sun, J.Q. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wso | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsk | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS-Cov-2 main protease, pH=8.5 | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsj | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS-Cov-2 main protease, pH=6.5 | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsi | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS-Cov-2 main protease, pH=6.0 | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsh | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS-Cov-2 main protease, pH=4.0 | Authors: | Zhou, X.L., Jiang, H.H., Zhang, J., Li, J. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8wsg | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase state 3 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsf | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 3 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wse | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase state 2 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsd | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 2 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsc | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase state 1 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsb | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 1 | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | Deposition date: | 2023-10-17 |
|
PDBID: | 8wsa | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-17 |
|
PDBID: | 8ws9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM mini structure of Cas12-1 with 5 nt complementary heteroduplex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-17 | Release date: | 2024-10-17 |
|
PDBID: | 8ws8 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM mini structure of Cas12-1/crRNA/Target DNA complex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8ws7 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM mini structure of Cas12-1 with 10 nt complementary heteroduplex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8ws6 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM mini structure of Cas12-1 with 14 nt complementary heteroduplex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8ws5 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of Cas12-1-N2/crRNA/Target DNA complex | Authors: | Kuo, Z., Xi, Z. | Deposition date: | 2023-10-16 | Release date: | 2024-10-16 |
|
PDBID: | 8ws4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-16 |
|
PDBID: | 8ws3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-16 |
|
PDBID: | 8ws2 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Crystal Structure of 5''-Deoxy-5''-methylthioadenosine phosphorylase from Aeropyrum pernix (R32 form) complex with 5''-Deoxy-5''-methylthioadenosine | Authors: | Iizuka, Y., Tsunoda, M. | Deposition date: | 2023-10-16 |
|
PDBID: | 8ws1 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human NEK7 D161N mutant | Authors: | Bijpuria, S., Kanavalli, M., Subbiah, R., Mollard, A., Bearss, D. | Deposition date: | 2023-10-16 |
|