| PDBID: | 8z7e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8z7d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8z7c | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8z7b | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of NTD-SD1-RBD-ACE2) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 8z79 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z78 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Procerain-B from Calotropis gigantea with glycerol | | Authors: | Kumar, A., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z73 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of AF9 in complex with H3K9la peptide | | Authors: | Li, H.T., Ma, H.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z72 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | MMS-ATM/Tel1 in Open state | | Authors: | Wang, P. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z71 | | Status: | HPUB -- hold until publication | | Title: | State 1a (S1a) of yeast 80S ribosome bound to open eEF3 and 2 tRNAs and eEF1A during mRNA decoding | | Authors: | Cheng, J., Wu, C.L., Li, J.X., Zhang, X.Z. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z70 | | Status: | HPUB -- hold until publication | | Title: | State 1 (S1) of yeast 80S ribosome bound to 2 tRNAs during mRNA decoding | | Authors: | Cheng, J., Wu, C.L., Li, J.X., Zhang, X.Z. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6z | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH-WT | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6y | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH mutant-V164K&V221A&H333K | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6x | | Status: | HPUB -- hold until publication | | Title: | Structure of EG.5.1 RBD in complex with antibody CYFN1006-2. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6w | | Status: | HPUB -- hold until publication | | Title: | Structure of EG.5.1 S trimer with 3 down-RBDs complex with antibody CYFN1006-2. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6v | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6u | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 EG.5.1 Spike in complex with CYFN1006-2(S-CYFN1006-2 dimer trimer). | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6t | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 RBD in complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6s | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 S trimer with 2 down-RBDs complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6r | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 S trimer with 3 down-RBDs complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6q | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 XBB.1.16 Spike in complex with CYFN1006-1(S-CYFN1006-1 dimer trimer). | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Procerain-B from Calotropis gigantea | | Authors: | Kumar, A., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HDGFRP2 PWWP domain in complex with Varenicline | | Authors: | Wei, X., Ruan, K. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
