| PDBID: | 9bev | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110A in complex with a lambda-carrageenan oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9beu | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110B in complex with a lambda-carrageenan oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bet | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bes | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8A, a lambda-carrageenan specific sulfatase, in complex with monosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9ber | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9beq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bep | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8C, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9beo | | Status: | HPUB -- hold until publication | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with 7.5 tungstates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9ben | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bem | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with seven Tungstates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bel | | Status: | HPUB -- hold until publication | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with five Tungstates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bek | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bej | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beh | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110A in complex with galactose-6-sulfate | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bef | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bee | | Status: | HPUB -- hold until publication | | Title: | alphaB-crystallin N-terminal IXI variant in a fibril state | | Authors: | McFarland, R., Reichow, S.L. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bed | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight molybdates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bec | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beb | | Status: | HPUB -- hold until publication | | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight Tungstates bound | | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bea | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS CoV-2 full-length spike protein with internal tag, 2RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9be9 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 Env 16055 dGly4 NFL | | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9be8 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be7 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
