| PDBID: | 9g7l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9g7j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the tungsten-dependent aldehyde:ferredoxin oxidoreductase from Clostridium autoethanogenum. | | Authors: | Lemaire, O.N., Wagner, T. | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9g7i | | Status: | HPUB -- hold until publication | | Title: | Structure of carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) in complex with acetyl-Coenyzme A from Clostridium autoethanogenum | | Authors: | Lemaire, O.N., Dongsheng, Y.M., Murphy, B.J., Wagner, T. | | Deposition date: | 2024-07-21 | | Sequence: | >Entity 1
MNLFQTVFTGSKQALAAAEGIVKQAVDEKGRDYKVAFPDTAYSLPVIFAATGKKITNVGELEGALDIVRSLIVEEEMLDKLLNSGLATAVAAEIIEAAKYVLSDAPYAEPCVGFISDPIIRSLGVPLVTGDIPGVAVILGECPDSETAAKIIKDYQSKGLLTCLVGKVIDQAIEGKVKMGLDLRVIPLGYDVTSVIHVVTIAIRAALIFGGIKGGQLNDILKYTAERVPAFVNAFGPLSELVVSAGAGAIALGFPVLTDQVVPEVPTLLLTQKDYDKMVKTSLEARNIKIKITEIPIPVSFAAAFEGERIRKNDMLAEFGGNKTKAWELVMCADQGEVEDHKIEVIGPDIDTIDKAPGRMPLGMLIKVSGTNMQKDFEPVLERRLHYFLNYIEGVMHVGQRNLTWVRIGKEAFEKGFRLKHFGEVIYAKMLDEFGSVVDKCEVTIITDPGKAEELEGKYAVPRYKERDARLESLVDEKVDTFYSCNLCQSFAPAHVCIVTPERLGLCGAVSWLDAKATLELNPTGPCQAVPKEGVVDENLGIWEKVNETVSKISQGAVTSVTLYSILQDPMTSCGCFECITGIMPEANGVVMVNREFGATTPLGMTFGELASMTGGGVQTPGFMGHGRQFIASKKFMKGEGGLGRIVWMPKELKDFVAEKLNKTAKELYNIDNFADMICDETIATESEEVVKFLEEKGHPALKMDPIM
>Entity 2
MEEKAKSIDQATLQLLDKAKQDGVETVWDRKADMKVQCGFGSAGVCCRNCSMGPCRVSPVPGKGVERGICGATADVIVSRNFARMVAAGTAAHSDHGRSIALSLYHTSKDGDIKVKDENKLKEVAKSFNVETEGRDIYDIAHDVAKEGLSNYGKQLGEVTLPPSLPEKRKELWRKLGVYPRAVDREIAAVMHSTHIGCNADAEAMIKMSMRCSLTDGWMGSFMGTEFSDIMFGTPHSIDTEANLGVLEKNSVNVVLHGHEPLLSEMVVEAASDPELVELAKSVGADGINLCGMCCTGNEVSMRHGIKIAGNFMQQELAVVTGAVDGLIVDVQCIMPALAKLSKSYHTKFITTSPKAHITDSIYMEFDEENPLDSAKKILKEAILNFKNRDQSKVMIPELKCKAILGYSVEEIINKLDKVVNTQIGPMQTVKPLADVLVSGVLRGAAAVVGCNNPKVVQDSAHIETIKGLIKNDVIVVVTGCAAQAAAKYGLLQKEAAEKYAGPGLATVCKLVDIPPVLHMGSCVDISRILDLVGRVANLLGVDMSDLPVAGVAPEWMSEKAVAIGTYVVTSGIDTWLGVAPPVTGGPEVVDILTNKMEDWVGAKFFIETDPHKAVEQIVNRMNEKRKKLGI
|
|
| PDBID: | 9g7g | | Status: | HPUB -- hold until publication | | Title: | Structure of the clippase PaJOS from Pigmentiphaga aceris | | Authors: | Baumann, U., Uthoff, M., Hermanns, T., Hofmann, K. | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9g7f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g7e | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ASGPR with bound guanosine | | Authors: | Schreuder, H.A., Hofmeister, A. | | Deposition date: | 2024-07-20 | | Sequence: | >Entity 1
MGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLLGSHHHHHH
|
|
| PDBID: | 9g7d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ASGPR with bound IMP | | Authors: | Schreuder, H.A., Hofmeister, A. | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g7c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g7a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g79 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g78 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g77 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g76 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ASGPR with bound GalNAc | | Authors: | Schreuder, H.A., Hofmeister, A. | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g73 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g72 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of S. epidermidis ClpP in complex with tavaborole - soaking | | Authors: | Alves Franca, B., Rohde, H., Betzel, C. | | Deposition date: | 2024-07-19 | | Release date: | 2024-08-16 |
|
| PDBID: | 9g71 | | Status: | HPUB -- hold until publication | | Title: | TTYH2 with lipids in GDN | | Authors: | Sukalskaia, A., Weber, F., Plochberger, B., Dutzler, R. | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g70 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g6z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | C. elegans TOFU-6 eTUDOR TOFU-1 peptide complex | | Authors: | Ketting, R., Falk, S. | | Deposition date: | 2024-07-19 | | Release date: | 2024-08-16 |
|
| PDBID: | 9g6y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g6x | | Status: | HPUB -- hold until publication | | Title: | TTYH2 in complex with sybody 1 in GDN | | Authors: | Sukalskaia, A., Weber, F., Plochberger, B., Dutzler, R. | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-19 |
|
