| PDBID: | 9il0 | | Status: | HPUB -- hold until publication | | Title: | Uracil-liganded strcuture of Nucleoside hydrolase 1 (NSH1) from Arabidopsis thaliana | | Authors: | Byun, S.J., Rhee, S.K. | | Deposition date: | 2024-06-29 |
|
| PDBID: | 9ikz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-29 |
|
| PDBID: | 9iky | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 1-2C-T96F TCR in complex with HLA-A*11:01 bound to KRAS-G12V peptide (VVGAVGVGK) | | Authors: | Ma, K.K., Tan, S.G., Gao, G.F., Chai, Y. | | Deposition date: | 2024-06-29 |
|
| PDBID: | 9ikx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-29 |
|
| PDBID: | 9ikw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-29 |
|
| PDBID: | 9ikv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-29 |
|
| PDBID: | 9iku | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Se-Met CTB10 | | Authors: | Fu, K., Rao, Y.J. | | Deposition date: | 2024-06-29 |
|
| PDBID: | 9ikt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the tetrapyrrole binding domain in CoaR at 2 angstrom resolution | | Authors: | Liu, X.C. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9iks | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Tubulin-DARPIN AC2 | | Authors: | Yan, W., Yang, J.H. | | Deposition date: | 2024-06-28 | | Release date: | 2025-06-28 |
|
| PDBID: | 9ikr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tubulin-RB3-TTL-IKP105 | | Authors: | Yang, J.H., Yang, J.H. | | Deposition date: | 2024-06-28 | | Release date: | 2025-06-28 |
|
| PDBID: | 9ikq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9ikp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human malectin | | Authors: | Si, Y.L. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9iko | | Status: | HPUB -- hold until publication | | Title: | VF16QK in free solution | | Authors: | Swaleeha, A., Bhattacharyya, S. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9ikm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9iki | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Nitrous Oxide-bound Fully Reduced State | | Authors: | Muramoto, K., Ide, T., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikh | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Nitrous Oxide-bound Fully Oxidized State | | Authors: | Muramoto, K., Ide, T., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikg | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Carbon Dioxide-bound Fully Reduced State | | Authors: | Muramoto, K., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikf | | Status: | HPUB -- hold until publication | | Title: | Bovine Heart Cytochrome c Oxidase in the Carbon Dioxide-bound Fully Oxidized State | | Authors: | Muramoto, K., Shinzawa-Itoh, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ike | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CDK12/Cyclin K in complex with covalent inhibitor | | Authors: | Huang, W.X., Zhou, K.J., Yang, J.Z., Ding, K. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ikd | | Status: | HOLD -- hold until a certain date | | Title: | The apo structure of the MazF-mt3 toxin | | Authors: | Xie, W., Jiang, P. | | Deposition date: | 2024-06-27 | | Release date: | 2025-06-27 |
|
| PDBID: | 9ikb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of heterotrimeric Kinesin-2 | | Authors: | Ren, J., Zhao, L., Feng, W. | | Deposition date: | 2024-06-27 | | Sequence: | >Entity 1
HHHHSQDGGAYSDERQDLDQTIAEVSKELKLKLLIVENFIPRDVSERIKERAEWNEDSFEWNVNAFQSTSSNSSTPLNNTIEVNEDGVFTRSSGADSGVSVSGGNGTPATSQFLDKRLVATPGCRRPMSMCERMLVETAREQFGAQRRPPISGSGSFVEATIPEETIRFCGENVVVFSALERFVPEVTDSDPSTFSNSMMMSARRPSIENLTIDASKVLVPILNQSTMILKNSKNGQARNDTMPPNGSMRRSQN
>Entity 2
EDHQRQVEAMLDDIRQLRKELLLNIAIIDEYIPVEHVELIEKYVSWSEEHGDWQLKAIAYTGNNMRASAPPAKKEFSNNNQTVPMYYSYRADLGASTAEHRPRTSSKKHRASIRLQQLLT
>Entity 3
ELGKIDEYIECFYGETSVEKNKGAVALYELSKNPQNLTQLVNNETLMMALARVFREDWKKHFEVGTNIMNLFVNISKFSCLHGILLHHKIGTLCVNAMEHETKRYDFWIAEMKKTDQETLRKLKTAIRKQAMLLAACVTFLTNLATDISVELKMVRRNLVALLVKCLQMSSESTSSLTTATIKFLLKLSIFDENKIVMEQNGTIEKLLKLFPIQDPELRKAVIMLLFNFSFDSKNLPKMVNGGLVPHMASLLDSDTKALNMMYLLSCNDDAKAMLAYTDAIKLLMKDVLSGTGSEVTKAVLLNICLEKRNAQLVCGQRGQGLDLLMEMSINSRDLMLIKVVRAISSHEGATQNMFLKWIETLIGIAKNEGADNSESKSSFGLECMGTVAELKVAPWAKIIQSENLVPWMKTQLQEGIDESEEVTVLRDIKPLQLQIVIACGTMARQLDAARLLAPLIDTFVQLLQSCQIDDEFVVQLLYVFLQFLKHKELSARLMTQDSALGAHMIDLMHDANAVVREVCDNALLIMGEHSKEWAKRIAGERFKWHNAQWLEMVERDDSEFVDYDDEDFGADLKFDHYDDGFDMNEPLF
|
|
| PDBID: | 9ika | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the tetrapyrrole binding domain in CoaR | | Authors: | Liu, X.C. | | Deposition date: | 2024-06-26 |
|
