PDBID: | 8trx | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8trw | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 | Release date: | 2025-02-10 |
|
PDBID: | 8tru | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8trp | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-10 | Release date: | 2024-08-10 |
|
PDBID: | 8trk | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8tri | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8trh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 | Release date: | 2025-02-05 |
|
PDBID: | 8trf | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2025-02-09 |
|
PDBID: | 8trb | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8tra | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8tr8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8tr7 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8tr6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8tqy | Status: | HPUB -- hold until publication | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | Deposition date: | 2023-08-08 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8tqw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-08 | Release date: | 2025-02-05 |
|
PDBID: | 8tqn | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tqf | Status: | HPUB -- hold until publication | Title: | Crystal structure of Soybean SHMT8 in complex with PLP-glycine and diglutamylated 5-formyltetrahydrofolate | Authors: | Owuocha, L.F., Beamer, L.J. | Deposition date: | 2023-08-07 |
|
PDBID: | 8tqc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8toy | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2025-02-04 |
|
PDBID: | 8tog | Status: | HPUB -- hold until publication | Title: | X-Ray Structure Determination of Dihydromethanopterin Reductase (DmrA) from Methylobacterium extorquens AM1 in a P6522 Space Group at a Resolution of 1.56 Angstroms | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbing, M., Collazo, M.J., Potla, S. | Deposition date: | 2023-08-03 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8to4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-02 | Release date: | 2024-08-14 |
|