| PDBID: | 8z7p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7o | | Status: | HPUB -- hold until publication | | Title: | PRMT1-Filament | | Authors: | Nadendla, E.K., Wang, C.H. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of HIV-1 CH119 SOSIP.664 trimer in complex with CD4 molecules | | Authors: | Li, D., Wang, T. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7l | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of S-bottom) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hemolysin co-regulated protein 1 (Hcp1) VariantB from Burkholderia pseudomallei | | Authors: | Lebedev, A.A., Charoenwattanasatien, R., Tandhavanant, S., Chantratita, N. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7i | | Status: | HPUB -- hold until publication | | Title: | Mec1-Ddc2 and Nb32R | | Authors: | Zheng, Z. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7h | | Status: | HPUB -- hold until publication | | Title: | PRMT1-Decamer | | Authors: | Nadendla, E.K., Wang, C.H. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of intact S2) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7f | | Status: | HPUB -- hold until publication | | Title: | Mec1-Ddc2 and Nb25-26R | | Authors: | Zheng, Z. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8z7d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8z7c | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8z7b | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of NTD-SD1-RBD-ACE2) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 8z79 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z78 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Procerain-B from Calotropis gigantea with glycerol | | Authors: | Kumar, A., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z73 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of AF9 in complex with H3K9la peptide | | Authors: | Li, H.T., Ma, H.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z72 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MMS-ATM/Tel1 in Open state | | Authors: | Wang, P. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z71 | | Status: | HPUB -- hold until publication | | Title: | State 1a (S1a) of yeast 80S ribosome bound to open eEF3 and 2 tRNAs and eEF1A during mRNA decoding | | Authors: | Cheng, J., Wu, C.L., Li, J.X., Zhang, X.Z. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z70 | | Status: | HPUB -- hold until publication | | Title: | State 1 (S1) of yeast 80S ribosome bound to 2 tRNAs during mRNA decoding | | Authors: | Cheng, J., Wu, C.L., Li, J.X., Zhang, X.Z. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6z | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH-WT | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6y | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH mutant-V164K&V221A&H333K | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
