| PDBID: | 8zh7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of N-terminal domain of N-methyl-D-aspartate receptor subunit NR1 in complex with patient-derived antibody | | Authors: | Nomura, N., Kumazaki, K., Amano, Y. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh2 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate and Communesin K | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh1 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh0 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with metal Iron | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 | | Sequence: | >Entity 1
MGSSWSHPQFEKMSTVDTAPQSHYQETKVSEIPIVILKSSATDDVAAHEAIEALKVAGVCIVRNLLDRSTVDKVRQELQPYDKQADSFEGFPKNYCQVAGLLSKSPTYAHSIVGNKLFTAVRNYFLTSTYECWAEKGTWMSVKSPPQLDSTLALYVNPGSGDQGLHRDDATQQNWNSGASEYSLGRDSGCAMMVALTECAREDGTTRFIPGSHLWDYQYDHPSNDDPRIRYAEMRPGDAYLMLSSVIHAGSVNYSTDRRRVLAAVFAARSHLRQVENQYLTYDIETVRTFPTWLQRFMGYSLSKLFQGWVDKKDPLLVVDPNAQPEGEDDGGMKPNEGEHVVEAQI
|
|
| PDBID: | 8zgz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of inward state Anhydromuropeptide permease (AmpG) | | Authors: | Cho, H.S., Kim, U., Chang, N., Kim, H., Yoo, Y. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgw | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_F248Y&D303E from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgv | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_F248A&D303E from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PvdL-E2-C3-A3-PCP3 in complex with MLP (NRPS cross-module) | | Authors: | Wei, C., Jialiang, W., Zhijun, W. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgp | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of dimeric quinol dependent nitric oxide reductase from Neisseria meningitidis | | Authors: | Gopalasingam, C.C., Shiro, Y., Tosha, T. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgo | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of monomeric quinol dependent nitric oxide reductase from Neisseria meningitidis | | Authors: | Gopalasingam, C.C., Shiro, Y., Tosha, T. | | Deposition date: | 2024-05-09 | | Sequence: | >Entity 1
MGQYKKLWYLLFAVLAVCFTILGYMGSEVYKKAPPYPEQVVSASGKVLMAKDDILAGQSAWQTTGGMEVGSVLGHGAYQAPDWTADWLHRELSAWLDLTAQQTYGKKFDEVSPEEQAVLKTRLADEYRNQSRIKEDGSVVISDTRVKAIESILPYYHGVYGDDPALQTTREHFAMKNNTLPSQEAREKLFDFFFWTSWSASTNRPDETFTYTNNWPHEPLINNVPTTENYMWSFTSVVLLLMGIGLLMWGYSFLTKHEEVEVPTEDPISKVQLTPSQKALGKYVFLTVALFVVQVLLGGLTAHYTVEGQGFYGIDEALGFEMSDWFPYALTRTWHIQSAIFWIATGFLTAGLFLAPIVNGGKDPKFQRAGVNFLYIALFIVVGGSYAGNFFALTHILPPEFNFWFGHQGYEYLDLGRFWQLLLMVGLLLWLFLMLRCTVSAFKEKGVDKNLLAIFVASMVGVGVFYAPGLFYGEKSPIAVMEYWRWWVVHLWVEGFFEVFATAAFAFVFYNMGFVRRSTATASTLAAAAIFMLGGVPGTLHHLYFSGSTSASMAIGACFSALEVVPLVLLGREAYEHWSYQHLSEWAKRLRWPLMCFVAVAFWNMIGAGVFGFLINPPISLFYIQGLNTSAVHAHAALFGVYGFLALGFVLLVARYLKPNVQFDDKLMTWGFWLLNGGLVGMIAISLLPVGVIQAYASITHGLWYARSEEFLQMEILDTLRWVRTAADLIFIGGAICVAIQATKIVFGRDK
|
|
| PDBID: | 8zgn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-09 | | Release date: | 2025-05-09 |
|
| PDBID: | 8zgh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zge | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
