PDBID: | 8yi7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 | Sequence: | >Entity 1 LSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASHHHHHH
>Entity 2 AIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
>Entity 3 KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEHHHHHH
>Entity 4 CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPHHHHHH
|
|
PDBID: | 8yi6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 8yi5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8yi4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8yi3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8yi2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8yi1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8yi0 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-28 |
|
PDBID: | 8yhz | Status: | HOLD -- hold until a certain date | Title: | The co-crystal structure of the Fab fragment of Ab-1080 with NaV1.7 VSDII peptide | Authors: | Juanjuan, D., Yaning, Z., Rui, Z., Yanchao, D. | Deposition date: | 2024-02-28 | Release date: | 2025-02-28 |
|
PDBID: | 8yhy | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-28 |
|
PDBID: | 8yhx | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the trimeric HerA | Authors: | Zhen, X., Zhou, B., Xiong, X. | Deposition date: | 2024-02-28 | Release date: | 2025-02-28 |
|
PDBID: | 8yhu | Status: | AUTH -- processed, waiting for author review and approval | Title: | hTLR3/minibinder 8.6 | Authors: | Kim, H., Kim, H. | Deposition date: | 2024-02-28 |
|
PDBID: | 8yht | Status: | HPUB -- hold until publication | Title: | hTLR3/minibinder 7.7 | Authors: | Kim, H., Kim, H. | Deposition date: | 2024-02-28 |
|
PDBID: | 8yhq | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in pyraclostrobin-bound state | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | Deposition date: | 2024-02-28 |
|
PDBID: | 8yho | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-28 | Release date: | 2025-02-28 |
|
PDBID: | 8yhn | Status: | HPUB -- hold until publication | Title: | Crystal structure of Cytochrome P450 107P2 from streptomyces avermitilis | Authors: | Jeong, E.S., Kim, V.C., Kim, C.M., Lee, Y.B. | Deposition date: | 2024-02-28 |
|
PDBID: | 8yhm | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-28 |
|
PDBID: | 8yhg | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-28 |
|
PDBID: | 8yhe | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8yhd | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8yhc | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of human cytosolic NADP(+)-dependent malic enzyme in complex with small molecules | Authors: | Huang, S.J., Wen, W.Y. | Deposition date: | 2024-02-28 | Release date: | 2025-02-28 |
|
PDBID: | 8yhb | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of human cytosolic NADP(+)-dependent malic enzyme in ternary complex with NADP+ and Mn2+ | Authors: | Huang, S.J., Wen, W.Y. | Deposition date: | 2024-02-28 | Release date: | 2025-02-28 |
|
PDBID: | 8yha | Status: | HPUB -- hold until publication | Title: | pro-RNA-DNA complex 60-4 | Authors: | Li, Z. | Deposition date: | 2024-02-27 |
|
PDBID: | 8yh9 | Status: | HPUB -- hold until publication | Title: | pro-RNA complex | Authors: | Li, Z. | Deposition date: | 2024-02-27 |
|
PDBID: | 8yh8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | F1 domain of Non-catalytic site depleted and epsilon C-terminal domain deleted FoF1-ATPase from Bacillus PS3,under ATP saturated condition | Authors: | Kobayashi, R., Nakano, A., Mitsuoka, K., Yokoyama, K. | Deposition date: | 2024-02-27 |
|