| PDBID: | 9bsi | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-B-7 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bsh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 | | Sequence: | >Entity 1
MNNSKIISKVLLSLSLFTVGASAFVIQDELMQKKHAKAEVSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFAHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
|
|
| PDBID: | 9bsg | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-C-20 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bsf | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-A-171 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bse | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-165 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bsd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsa | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-B-112 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bs9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bs8 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-107 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bs7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor Vinylpyridine | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bs6 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of ThermoCas9 in post-cleavage state with a DNA containing NNNNCGA PAM | | Authors: | Zhao, Y., Shu, Y. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bs5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bacteroides ovatus GH97C Sus | | Authors: | Brown, H.A., Koropatkin, N.M. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bs4 | | Status: | HPUB -- hold until publication | | Title: | DNA Ligase 1 E346A/E592A double mutant with 5''-rG:C | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2024-05-12 |
|
| PDBID: | 9bs3 | | Status: | HPUB -- hold until publication | | Title: | Wild type DNA Ligase 1 with 5''-rG:C | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2024-05-12 |
|
| PDBID: | 9bs2 | | Status: | HPUB -- hold until publication | | Title: | Glycosylase MutY variant R149Q in complex with DNA containing d(8-oxo-G) paired with a product analog (THF) to 1.51 A resolution | | Authors: | Trasvina-Arenas, C.H., Tamayo, N., Lin, W.J., Demir, M., Fisher, A.J., David, S.S., Horvath, M.P. | | Deposition date: | 2024-05-12 | | Sequence: | >Entity 1
GSHMTRETERFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMQVLSRLFLVTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPIVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWASGVRPPP
>Entity 2
(DA)(DA)(DG)(DA)(DC)(8OG)(DT)(DG)(DG)(DA)(DC)
>Entity 3
(DT)(DG)(DT)(DC)(DC)(DA)(3DR)(DG)(DT)(DC)(DT)
|
|
| PDBID: | 9bs1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-12 |
|
| PDBID: | 9bs0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-12 |
|
| PDBID: | 9brx | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Papain-like Protease (PLpro) with Fragment 10 | | Authors: | Amporndanai, K., Zhao, B., Fesik, S.W. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brw | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Papain-like Protease (PLpro) with Fragment 7 | | Authors: | Amporndanai, K., Zhao, B., Fesik, S.W. | | Deposition date: | 2024-05-11 | | Sequence: | >Entity 1
MREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQSGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPLEHHH
|
|
| PDBID: | 9brv | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Papain-like Protease (PLpro) with Fragment 5 | | Authors: | Amporndanai, K., Zhao, B., Fesik, S.W. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brp | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL047-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9bro | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL030-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9brn | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL050-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
