| PDBID: | 9cy8 | | Status: | HPUB -- hold until publication | | Title: | Constrained b-hairpins targeting the EphA4 ligand binding domain | | Authors: | Muzzarelli, K.M., Assar, Z., Prentis, A.M., Baggio, C., Pellecchia, M. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy9 | | Status: | HOLD -- hold until a certain date | | Title: | Biofilm regulatory protein A from Streptococcus mutans | | Authors: | Hua, Z., Hui, W. | | Deposition date: | 2024-08-01 | | Release date: | 2025-08-01 |
|
| PDBID: | 9cy2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gbl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme C-domain in complex with a diprolyl inhibitor- SG3 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme C-domain in complex with a diprolyl inhibitor- SG15 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme C-domain in complex with a diprolyl inhibitor- SG16 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbp | | Status: | HPUB -- hold until publication | | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG3 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbf | | Status: | HOLD -- hold until a certain date | | Title: | X-RAY structure of PHDvC5HCH tandem domain of NSD2 | | Authors: | Musco, G., Cocomazzi, P., Berardi, A., Knapp, S., Kramer, A. | | Deposition date: | 2024-07-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 9gbh | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND1 | | Authors: | Schaefer, M., Fuerstner, C., Ackerstaff, J., Meier, H., Straub, A., Mittendorf, J., Schamberger, J., Boerngen, K., Joerissen, H., Zubow, D., Zimmermann, K., Tersteegen, A., Geiss, V., Hartmann, E., Albrecht-Kuepper, B., Dorleans-Juste, P., Lapointe, C., Vincent, L., Heitmeier, S., Tinel, H. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG15 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG17 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Human Anaplastic Lymphoma Kinase (ALK) harboring the G1202R/L1196M Compound Mutation in Complex with NVL-655 | | Authors: | Mente, S., Horan, J.C. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI wild-type | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbg | | Status: | HPUB -- hold until publication | | Title: | Putative Phage Recombinase UvsX | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gc0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-07-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 9gbs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme N-domain in complex with a diprolyl inhibitor- SG18 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gby | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pseudomonas aeruginosa IspD | | Authors: | Borel, F., D''Auria, L. | | Deposition date: | 2024-07-31 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
| PDBID: | 9gbw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
