| PDBID: | 9cv8 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Cytochrome P450 NysL bound to nystatin | | Authors: | Murarka, V.C., Poulos, T.L. | | Deposition date: | 2024-07-28 |
|
| PDBID: | 9cv1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the metallo-beta-lactamase VIM-15 with L-captopril | | Authors: | Silwal, S.B., Nix, J.C., Page, R.C. | | Deposition date: | 2024-07-28 | | Sequence: | >Entity 1
GHMVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLFGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE
|
|
| PDBID: | 9cv2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the metallo-beta-lactamase VIM-20 with D-captopril | | Authors: | Silwal, S.B., Nix, J.C., Page, R.C. | | Deposition date: | 2024-07-28 | | Sequence: | >Entity 1
GHMVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQRYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE
|
|
| PDBID: | 9cv3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the metallo-beta-lactamase VIM-20 with L-captopril | | Authors: | Silwal, S.B., Nix, J.C., Page, R.C. | | Deposition date: | 2024-07-28 | | Sequence: | >Entity 1
GHMVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQRYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE
|
|
| PDBID: | 9cv4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the metallo-beta-lactamase VIM-31 with D-captopril | | Authors: | Silwal, S.B., Nix, J.C., Page, R.C. | | Deposition date: | 2024-07-28 | | Sequence: | >Entity 1
GHMVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIHELSRTSAGNVADADLAEWPTSIERIQQRYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE
|
|
| PDBID: | 9cv5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the metallo-beta-lactamase VIM-31 with L-captopril | | Authors: | Silwal, S.B., Nix, J.C., Page, R.C. | | Deposition date: | 2024-07-28 | | Sequence: | >Entity 1
GHMVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSASVLYGGCAIHELSRTSAGNVADADLAEWPTSIERIQQRYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRSVVE
|
|
| PDBID: | 9cv7 | | Status: | HPUB -- hold until publication | | Title: | LJF-085 Fab in complex with HIV Env ZM233 NFL TD CC3+ trimer | | Authors: | Ozorowski, G., Ward, A.B. | | Deposition date: | 2024-07-28 |
|
| PDBID: | 9cv6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-28 |
|
| PDBID: | 9ixb | | Status: | PROC -- to be processed | | Title: | Structure of tubulin and nitrogen-containing heterocyclic substituted podophyllotoxin derivatives complex | | Authors: | Bi, J., Zhao, W. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixh | | Status: | HPUB -- hold until publication | | Title: | Apg mutant enzyme D448A of the human gut flora K. grimontii TD1 acarbose hydrolase | | Authors: | Zhou, J.H., Huang, J.Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Manganese-rebound N(omega)-hydroxy-L-arginine hydrolase with oxidized Cys86 | | Authors: | Oda, K., Matoba, Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Copper-bound N(omega)-hydroxy-L-arginine hydrolase with oxidized Cys86 | | Authors: | Oda, K., Matoba, Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Copper-bound N(omega)-hydroxy-L-arginine hydrolase without oxidized Cys86 | | Authors: | Oda, K., Matoba, Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Manganese-free N(omega)-hydroxy-L-arginine hydrolase with oxidized Cys86. | | Authors: | Oda, K., Matoba, Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9ixg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Manganese-free N(omega)-hydroxy-L-arginine hydrolase without oxidized Cys86 | | Authors: | Oda, K., Matoba, Y. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9cuz | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Bufavirus 1 complexed with 6SLN | | Authors: | Gulkis, M.C., McKenna, R., Bennett, A.D. | | Deposition date: | 2024-07-27 |
|
| PDBID: | 9gad | | Status: | HPUB -- hold until publication | | Title: | Structure and catalytic mechanism of SAM-AMP lyase in Clostridium botulinum CorA-associated type III CRISPR system | | Authors: | McMahon, S.A., Gloster, T.M., White, M.F., Graham, S., Chi, H. | | Deposition date: | 2024-07-26 | | Sequence: | >Entity 1
GANAMAHMGKTLRFEIVSGVNKGYFHTNSQSESLDLVGGIWQKIAKEEFEKSNIYVSAVIKPSKTVYNQEWGCPENGEETVVLTGVANEEFVDDIEKWKDTVIKLAKELKNQMKQSTLTCEFIETELHYFK
|
|
| PDBID: | 9gab | | Status: | HPUB -- hold until publication | | Title: | Structure and catalytic mechanism of SAM-AMP lyase in Clostridium botulinum CorA-associated type III CRISPR system | | Authors: | McMahon, S.A., Chi, H., Gloster, T.M., White, M.F., Graham, S. | | Deposition date: | 2024-07-26 | | Sequence: | >Entity 1
GANAMAHMGKTLRFEIVSGVNKGYFHTNSQSESLDLVGGIWQKIAKEEFEKSNIYVSAVIKPSKTVYNQEWGCPENGQETVVLTGVANEEFVDDIEKWKDTVIKLAKELKNQMKQSTLTCEFIETELHYFK
|
|
| PDBID: | 9ga9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure hASF1A 156-cr7 | | Authors: | Ochsenbein, F.O., Vitard, A.V. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga6 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of human Annexin A4 derived from crystals grown in 40 mM of CaCl2 | | Authors: | Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Bifulco, G., Campiglia, P., Sala, M., Scala, M.C., Ruggiero, A. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of human Annexin A4 derived from crystal grown at 4 mM CaCl2 and retro-soaking | | Authors: | Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Scala, M.C., Sala, M., Campiglia, P., Bifulco, G., Ruggiero, A. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga8 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of human Annexin A4 from crystals grown at 4 mM Calcium | | Authors: | Ruggiero, A., Barra, G., Ghilardi, O., Scala, M.C., Sala, M., Di Micco, S., Bifulco, G., Campiglia, P., Vitagliano, L. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga3 | | Status: | HPUB -- hold until publication | | Title: | MtUvrA2UvrB bound to damaged oligonucleotide | | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | | Deposition date: | 2024-07-26 |
|
