| PDBID: | 9nv3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Hybrid model of a complex of BREX proteins BrxB and PglZ from Salmonella typhimurium | | Authors: | Doyle, L.A., Stoddard, B., Blower, T.R., Kaiser, B. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvb | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human SMYD1 in complex with MYH2 peptide and SAH | | Authors: | Zeng, H., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP207 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nuz | | Status: | HPUB -- hold until publication | | Title: | Y20S after Mg2+ (Sec18) - Class 4 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv1 | | Status: | HPUB -- hold until publication | | Title: | Sec18 Mg2+ class 1 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv0 | | Status: | HPUB -- hold until publication | | Title: | Sec18 Mg2+ class 2 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv9 | | Status: | HPUB -- hold until publication | | Title: | NSF Mg2+ class 1 heptamer | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP101 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nva | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP105 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvd | | Status: | HPUB -- hold until publication | | Title: | NSF Mg2+ class 2 hexamer | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nve | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP203 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvg | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 BA.1 spike RBD bound to COV2-3835 Fab | | Authors: | Ramamohan, A.R., Johnson, N.V., McLellan, J.S. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvm | | Status: | HPUB -- hold until publication | | Title: | ATPase Hybrid F1 with the ancestral core domains Catalytic Dwell | | Authors: | Stewart, A.G., Noji, H., Sobti, M., Suzuki, A.K. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qlc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qku | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql2 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qla | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkv | | Status: | HPUB -- hold until publication | | Title: | Human myoferlin (1-1997) in complex with an MSP2N2 lipid nanodisc (15 mol% DOPS, 5 mol% Cholesterol) | | Authors: | Cretu, C., Moser, T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qle | | Status: | HPUB -- hold until publication | | Title: | Human myoferlin (1-1997) in complex with an MSP2N2 lipid nanodisc (15 mol% DOPS, 2 mol% PI(4,5)P2) | | Authors: | Cretu, C., Moser, T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql0 | | Status: | HOLD -- hold until a certain date | | Title: | E. coli IspH crystallized in the presence of adenosine hemisulfate | | Authors: | Bikbaev, K., Dormann, C., Span, I. | | Deposition date: | 2025-03-20 | | Release date: | 2026-03-20 |
|
| PDBID: | 9qkq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hTEAD4 YAP binding domain (hTEAD4-YBD) in complex with peptide 6 | | Authors: | Pozzi, C. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1
GSHMRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
>Entity 2
(ACE)P(6CW)RLRK(NLE)PDSF(ALN)KPP(NH2)
|
|
