| PDBID: | 9u4r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the intial complex in filament assembly at 3.23 angstroms resolution, conformation 2. | | Authors: | Chen, L.X., Jiang, W.X., Cheng, X.Q., Dong, X., Xing, Q. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u4t | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u58 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of AZ-GS bound AtABCC2 | | Authors: | Yang, G.-F., Dong, J.Q., Yang, T.-L. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u4s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u4v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u53 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the CYP154C2 Q230A from Streptomyces avermitilis | | Authors: | Xu, L.H. | | Deposition date: | 2025-03-20 | | Release date: | 2025-09-20 |
|
| PDBID: | 9u55 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qld | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-nitrophenol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9qkp | | Status: | HPUB -- hold until publication | | Title: | Structure of the cyanobacteria specific PRK from Chroococcidiopsis (Hyella disjuncta) PCC 6712 (P41212 crystal form) | | Authors: | Tufail, F., Yang, L., Murray, J.W. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qkz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qlb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u4z | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u4x | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u52 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR Solution Structures of CX-5461-MYT1L Complex | | Authors: | Li, Y., Cao, C. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u4u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9u51 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Hybrid model of a complex of BREX proteins BrxB and PglZ from Salmonella typhimurium | | Authors: | Doyle, L.A., Stoddard, B., Blower, T.R., Kaiser, B. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Co-crystal structure of human SMYD1 in complex with MYH2 peptide and SAH | | Authors: | Zeng, H., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP207 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nuz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Y20S after Mg2+ (Sec18) - Class 4 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Sec18 Mg2+ class 1 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Sec18 Mg2+ class 2 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
