PDBID: | 8vco | Status: | HPUB -- hold until publication | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcp | Status: | HPUB -- hold until publication | Title: | Crystal structure of dimeric rMcL-1 in complex with raffinose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcs | Status: | HPUB -- hold until publication | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactulose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vck | Status: | HPUB -- hold until publication | Title: | Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1) | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcf | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcl | Status: | HPUB -- hold until publication | Title: | Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide | Authors: | Ma, J., Baker, B.M. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the oligomeric rMcL-1 in complex with raffinose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcg | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8xg1 | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xfo | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of integrin ITGAV, ITGB3 and CYCLO (RGDFK) complex, conformation 2 | Authors: | Xi, Z. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xfw | Status: | HPUB -- hold until publication | Title: | Crystal structure of MiCGT(M148A/V190T/S121D) in complex with UDP | Authors: | Zhang, Z.M., Zhou, Z.Q. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xfp | Status: | HPUB -- hold until publication | Title: | the pentamerA complex of LGR4-RSPO2-ZNRF3(delta RING) | Authors: | Geng, Y., Wang, L. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xfs | Status: | HPUB -- hold until publication | Title: | LGR4-RSPO2-ZNRF3 RING domain (1:2:2) | Authors: | Lu, W. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xft | Status: | HPUB -- hold until publication | Title: | LGR4-RSPO2-ZNRF3(1:1:1) | Authors: | Lu, W. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xfu | Status: | HPUB -- hold until publication | Title: | DUF3055 from Staphylococcus aureus adopts unique strategy for structural distinctiveness | Authors: | Kim, H.J. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xg0 | Status: | AUTH -- processed, waiting for author review and approval | Title: | protein-DNA complex | Authors: | Li, Z. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xg3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of monomeric WDR11-FAM91A1 complex | Authors: | Jia, G.W., Deng, Q.H., Su, Z.M., Jia, D. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xfx | Status: | HPUB -- hold until publication | Title: | Archaeal exosome subcomplex (Rrp41-Rrp42) | Authors: | Kim, H.S., Park, S.H., Kim, S.H., Hwang, K.Y. | Deposition date: | 2023-12-14 |
|
PDBID: | 8rg4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 8rg3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 8rg6 | Status: | HPUB -- hold until publication | Title: | Arginase 2 in complex with inhibitor | Authors: | Petersen, J. | Deposition date: | 2023-12-13 |
|
PDBID: | 8rg7 | Status: | HPUB -- hold until publication | Title: | BmrA E504-R6G-25uMATP-Mg | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | Deposition date: | 2023-12-13 |
|
PDBID: | 8rga | Status: | HPUB -- hold until publication | Title: | BmrA E504-25uMATPMg | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | Deposition date: | 2023-12-13 |
|
PDBID: | 8rgj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|