| PDBID: | 8um8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8ume | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Influenza A virus Hemagglutinin H5/Vietnam/1204/2004 in complex with D04 Fab | | Authors: | Ferreira Ramos, A.S., Bajic, G. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8umj | | Status: | HPUB -- hold until publication | | Title: | Wild type EPSP synthase complexed with glyphosate and shikimate-3-phosphate | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8umi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8ulv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8um5 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human SHIP1 Ptase-C2 domains covalently bound to TREAT-AD (TAD) compound TAD-58547 | | Authors: | Mesecar, A.D., Hamdani, A.K. | | Deposition date: | 2023-10-17 | | Sequence: | >Entity 1
SMEQPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTVAIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAETIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKNGPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKFGETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHHGELTGHFQGEIKLQTSQ
|
|
| PDBID: | 8umf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8umh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8um0 | | Status: | HPUB -- hold until publication | | Title: | The structure of NanH in complex with Neu5,7,9Ac(2,6)-LAcNAc | | Authors: | Medley, B.J., Boraston, A.B. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 1 | | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase state 1 | | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 2 | | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase state 3 | | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsr | | Status: | HPUB -- hold until publication | | Title: | the structure of BtSY1_RBD/hACE2 protein | | Authors: | Xu, Z.P., Sun, J.Q. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsv | | Status: | HPUB -- hold until publication | | Title: | Pre-binding structure of HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) in presence of sub optimal concentration of 4-hydroxy benzoic acid | | Authors: | Goswami, A., Raju, R., Kasarla, M., Ullah, S. | | Deposition date: | 2023-10-17 | | Sequence: | >Entity 1
MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
| PDBID: | 8wsx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8ws1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human NEK7 D161N mutant | | Authors: | Bijpuria, S., Kanavalli, M., Subbiah, R., Mollard, A., Bearss, D. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ws2 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of 5''-Deoxy-5''-methylthioadenosine phosphorylase from Aeropyrum pernix (R32 form) complex with 5''-Deoxy-5''-methylthioadenosine | | Authors: | Iizuka, Y., Tsunoda, M. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8wrs | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1 with 5 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8wrr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cas12-1 with 10 nt complementary heteroduplex | | Authors: | Zhang, X., Zhang, K. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ws7 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1 with 10 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8wrt | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1/crRNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
