PDBID: | 9bsc | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsd | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsn | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsu | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsv | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bs7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor Vinylpyridine | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bs6 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of ThermoCas9 in post-cleavage state with a DNA containing NNNNCGA PAM | Authors: | Zhao, Y., Shu, Y. | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsh | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 | Sequence: | >Entity 1 MNNSKIISKVLLSLSLFTVGASAFVIQDELMQKKHAKAEVSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFAHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
|
|
PDBID: | 9bs8 | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-107 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsl | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsa | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-B-112 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bse | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-165 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bss | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsf | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-A-171 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsg | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-C-20 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsm | Status: | HPUB -- hold until publication | Title: | Staphylococcus aureus exfoliative toxin A D164E variant | Authors: | Holyoak, T., Tran, N. | Deposition date: | 2024-05-13 |
|
PDBID: | 9bsi | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-B-7 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bso | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-B-13 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsp | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-C-68 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsq | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-C-70 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bsr | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-136B | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9bst | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor CID8009_5647 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-13 | Release date: | 2025-05-13 |
|
PDBID: | 9fb5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-12 |
|
PDBID: | 9fb6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-12 |
|
PDBID: | 9fb7 | Status: | HPUB -- hold until publication | Title: | Dye-decolourising peroxidase DtpB (280 kGy) | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Strange, R.W., Owen, R.L. | Deposition date: | 2024-05-12 |
|