| PDBID: | 9bwn | | Status: | HPUB -- hold until publication | | Title: | Nanoparticle Crystal Structure of a Thermostabilized Mutant Rv1498A Flavoprotein from Mycobacterium tuberculosis | | Authors: | Seraj, N., Cappelli, L., Wahome, N., Cinelli, P., Fabiola, G., Cartocci, E., Delany, I., Cozzi, R. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Transport and Golgi Organization protein 2 Homolog (TANGO2) | | Authors: | Lovell, S., Cooper, A., Powers, A., Battaile, K.P., Mohsen, A.-W., Ghaloul-Gonzalez, L. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwe | | Status: | HPUB -- hold until publication | | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine at pH 6.4 in an intermediate state | | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwj | | Status: | HPUB -- hold until publication | | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine and 0.1 mM zinc in an apo state | | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwm | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Oxidized Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bwl | | Status: | PROC -- to be processed | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp in complex with butyryl-coA | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwo | | Status: | PROC -- to be processed | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp. in complex with acetyl-coA | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwp | | Status: | PROC -- to be processed | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp. in complex with acetoacetyl-coA. | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwq | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to the Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bwr | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to the Neutron Structure of Reduced Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9ff1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9fei | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9feg | | Status: | HPUB -- hold until publication | | Title: | PARP15 in complex with a quinazolin-4-one inhibitor | | Authors: | Bosetti, C., Lehtio, L. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zlk | | Status: | HPUB -- hold until publication | | Title: | PWWP domain from human DNMT3B | | Authors: | Cho, C.-C., Yuan, H.S. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zlj | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, shut state) | | Authors: | Chen, Q., Hu, H. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 8zlm | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 8zlg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zll | | Status: | HPUB -- hold until publication | | Title: | Apo state of hPAC | | Authors: | Chen, X., Su, N. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvi | | Status: | HPUB -- hold until publication | | Title: | Identification of multiple ligand hotspots on SOS2, compound 2 | | Authors: | Phan, J., Fesik, S.W. | | Deposition date: | 2024-05-20 |
|
