| PDBID: | 9gd6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gd8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gd9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TRIM24 PHD-BRD in complex with N-(2-(2-(2-acetamidoethoxy)ethoxy)ethyl)-3-(N-(1,3-dimethyl-2-oxo-6-(3-propoxyphenoxy)-2,3-dihydro-1H-benzo[d]imidazol-5-yl)sulfamoyl)benzamide (PEG linker unresolved) | | Authors: | Platt, M.A., Kot, E., Conway, S.J., Koekemoer, L. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdi | | Status: | HPUB -- hold until publication | | Title: | HUMAN PI3KDELTA IN COMPLEX WITH ISOCUMARIN INHIBITOR 10 | | Authors: | Pala, D., Bruno, P., Capelli, A.M., Biagetti, M. | | Deposition date: | 2024-08-05 | | Sequence: | >Entity 1
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
>Entity 2
YQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
|
|
| PDBID: | 9j1w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mouse Spi-B Ets domain in complex with DNA containing AGAA sequence | | Authors: | Nonaka, Y., Kamitori, S. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mouse Spi-B Ets domain in complex with DNA containing GGAA sequence | | Authors: | Nonaka, Y., Kamitori, S. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a mutant (PaDa-I) unspecific peroxygenase from Agrocybe aegerita | | Authors: | Liu, W., Zhang, J., Zhang, W. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1i | | Status: | HPUB -- hold until publication | | Title: | Apo structure of the F2Y224-FtmOx1 mutant with metal Iron | | Authors: | Wang, X.Y., Wang, J., Yan, W.P. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1h | | Status: | HPUB -- hold until publication | | Title: | The binary complex structure of F2Y224-FtmOx1 mutant with alpha-ketoglutarate | | Authors: | Wang, X.Y., Wang, J., Yan, W.P. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1j | | Status: | HPUB -- hold until publication | | Title: | Cap region of monocin | | Authors: | Wang, J.W., Gu, Z.W. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1k | | Status: | HPUB -- hold until publication | | Title: | Tip region of monocin | | Authors: | Wang, J.W., Gu, Z.W. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1l | | Status: | HPUB -- hold until publication | | Title: | Side fiber of monocin | | Authors: | Wang, J.W., Gu, Z.W. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis of the bifunctionality of M. salinexigens ZYF650T glucosylglycerol phosphorylase in glucosylglycerol catabolism | | Authors: | Lu, D., Ma, H.L. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9czs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 | | Release date: | 2025-08-05 |
|
| PDBID: | 9czq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9czh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9czj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ca2+ free hSlo1 + beta2N-beta4 channel in detergent. | | Authors: | Agarwal, S., Nimigean, C. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9czk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ca2+ free hSlo1 + beta2N-beta4 channel in nanodisc. | | Authors: | Agarwal, S., Nimigean, C. | | Deposition date: | 2024-08-05 |
|
