PDBID: | 8thy | Status: | HPUB -- hold until publication | Title: | yeast actin A167E mutant rabbit-like | Authors: | Volkmann, N., Hanein, D. | Deposition date: | 2023-07-18 |
|
PDBID: | 8pul | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8puj | Status: | HPUB -- hold until publication | Title: | The surface-exposed lipo-protein of BtuG2 in complex with cyanocobalamin. | Authors: | Whittaker, J., Martinez-Felices, J.M., Guskov, A., Slotboom, D.J. | Deposition date: | 2023-07-17 |
|
PDBID: | 8k48 | Status: | HPUB -- hold until publication | Title: | LTD of arabidopsis thaliana | Authors: | Wang, C., Xu, X.M. | Deposition date: | 2023-07-17 |
|
PDBID: | 8k3z | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of CXCR4 in complex with CXCL12 | Authors: | Liu, Y.Z., Liu, A.J., Liao, Q.W. | Deposition date: | 2023-07-17 |
|
PDBID: | 8puk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8pup | Status: | HPUB -- hold until publication | Title: | Influenza A/California/07/2009(H1N1) endonuclease in complex with purpurogallin-like compound | Authors: | Kotacka, T., Radilova, K. | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8pv0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 |
|
PDBID: | 8puz | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 |
|
PDBID: | 8puu | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8puv | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 |
|
PDBID: | 8tho | Status: | HPUB -- hold until publication | Title: | Solution structure of the zinc finger repeat domain of BCL11A (ZnF456) | Authors: | Viennet, T., Yin, M., Orkin, S.H., Arthanari, H. | Deposition date: | 2023-07-17 | Sequence: | >Entity 1 SEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE
|
|
PDBID: | 8thq | Status: | HPUB -- hold until publication | Title: | Nonamer RNA bound to hAgo2-PAZ | Authors: | Pallan, P.S., Harp, J.M., Egli, M. | Deposition date: | 2023-07-17 |
|
PDBID: | 8pu5 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Acyl-CoA dehydrogenase FadE1(PA0506) E441A from Pseudomonas aeruginosa complexed with C16CoA | Authors: | Wang, M., Brear, P., Welch, M. | Deposition date: | 2023-07-16 | Release date: | 2025-01-16 |
|
PDBID: | 8pu1 | Status: | HPUB -- hold until publication | Title: | Structure of the toxin/antitoxin complex FaRel/ATfaRel2 with APCPP | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8pu2 | Status: | HPUB -- hold until publication | Title: | Structure of the antitoxin ATfaRel2 | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8pu3 | Status: | HPUB -- hold until publication | Title: | Complex of the toxin/antitoxin FaRel2/ATfaRel2 | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8pu4 | Status: | HPUB -- hold until publication | Title: | FaRel2 bound to the ATP analogue, APCPP | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8k3l | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-16 |
|
PDBID: | 8k3o | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-16 |
|
PDBID: | 8k3j | Status: | HPUB -- hold until publication | Title: | Structure of human CNTN2 immunoglobulin domains 1-6 homo-dimer | Authors: | Zhang, Z.Z. | Deposition date: | 2023-07-16 |
|
PDBID: | 8ptv | Status: | HPUB -- hold until publication | Title: | IPNS variant N252Q in complex with Fe and ACV under anaerobic conditions | Authors: | Rabe, P., Schofield, C.J. | Deposition date: | 2023-07-15 |
|
PDBID: | 8k3h | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of PseP with NAD at 2.86 angstrom resolution | Authors: | Mori, T., Awakawa, T., Adachi, N., Abe, I. | Deposition date: | 2023-07-15 |
|
PDBID: | 8k3i | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of PseP apo | Authors: | Mori, T., Awakawa, T., Adachi, N., Abe, I. | Deposition date: | 2023-07-15 |
|
PDBID: | 8thf | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-15 |
|