| PDBID: | 9hto | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht7 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site and A-site tRNAs | | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Tetraspanin CD82 Large Extracellular Loop (LEL) | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of YIUA from Yersinia ruckeri with Iron and nitrilotriacetic acid | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht9 | | Status: | HPUB -- hold until publication | | Title: | CutC in complex with inhibitor1 | | Authors: | Petersen, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hs9 | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P460 from Methyloccocus capsulatus (unclear crosslink from Lys), damage-free | | Authors: | Pfalzgraf, H.E., Adams, H.R., Sugimoto, H., Tosha, T., Horrell, S., Jaho, S., Beilsten-Edmands, J., Tews, I., Worrall, J.A.R., Owen, R.L., Hough, M.A. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht8 | | Status: | HPUB -- hold until publication | | Title: | Peptide-substrate-binding (PSB) domain of human type I collagen prolyl 4-hydroxylase complexed with Pro-Pro-Gly-Pro-Ala-Gly-Pro-Pro-Gly. | | Authors: | Sulu, R., Rahman, M.M., Wierenga, R.K., Koski, M.K. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htc | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 1600 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htb | | Status: | HPUB -- hold until publication | | Title: | CutC in complex with inhibitor2 | | Authors: | Petersen, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crosslinked complex of ketosynthase FabB mutant FabBG107M and acyl carrier protein AcpP from E.coli with C12 crosslinker | | Authors: | Jiang, Z., Sankaran, B., Burkart, M.D., Fox, J.M. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mm3 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH9.5-pH8; 4s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 9.5 and soaked in pH 8 for 4s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hti | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PA0884, the SBP component of a Pseudomonas aeruginosa PAO1 Tripartite ATP-independent Periplasmic (TRAP) transporter, complexed with itaconate | | Authors: | Herman, R., Mehboob, J., Elston, R., Afolabi, H., Kinniment-Williams, B.E., Wilkinson, A.J., Thomas, G.H. | | Deposition date: | 2024-12-19 | | Sequence: | >Entity 1
AQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
| PDBID: | 9ht0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htd | | Status: | HPUB -- hold until publication | | Title: | Peptide-substrate-binding (PSB) domain of human type II collagen prolyl 4-hydroxylase complexed with Pro-Hyp-Gly-Pro-Ala-Gly-Pro-Hyp-Gly. | | Authors: | Sulu, R., Rahman, M.M., Wierenga, R.K., Koski, M.K. | | Deposition date: | 2024-12-19 |
|
