| PDBID: | 9jnq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9jnr | | Status: | HPUB -- hold until publication | | Title: | McyI-MCLR co-crystal | | Authors: | Wang, Q., Xue, C. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9jns | | Status: | HPUB -- hold until publication | | Title: | 50S precursor - Erm complex (C-1) | | Authors: | Sengupta, S., Mukherjee, R., Pilsl, M., Bagale, S., Adhikary, A.D., Borkar, A., Pradeepkumar, P.I., Engel, C., Chowdhury, A., Kaushal, P.S., Anand, R. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dpz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Potent inhibition of the protein arginine deiminases (PAD1-4) by targeting a Ca2+ dependent allosteric binding site | | Authors: | Liu, S. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dq6 | | Status: | HPUB -- hold until publication | | Title: | TREK2-HH in complex with Nb76, copper(II) and phosphatidylserine | | Authors: | Bahramimoghaddam, H., Laganowsky, A. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dqa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of bovine RPE65 in complex with PG90 | | Authors: | Kiser, P.D., Bassetto, M. | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9dqb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-23 |
|
| PDBID: | 9gv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jmy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-22 | | Release date: | 2025-09-22 |
|
| PDBID: | 9jn1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Multidrug resistance-associated protein 2 in complex with AMP-PNP in active state | | Authors: | Chen, D.D., Zhao, P. | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9jn7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human ALK2 kinase domain with R206H mutation in complex with RK783 | | Authors: | Sakai, N., Mishima-Tsumagari, C., Shirouzu, M. | | Deposition date: | 2024-09-22 |
|
| PDBID: | 9dph | | Status: | AUCO -- author corrections pending review | | Title: | Solution Structure of T35S mutant of KRAS4b-GppNHp | | Authors: | Sharma, A.K., Maciag, A.E. | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9dpi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SerRS dimer in complex with two SIRT2 | | Authors: | Yang, J., Zhang, Q., Lander, G., Yang, X. | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9gv3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex between Nb474 mutant R53A,D125A and Trypanosoma congolense fructose-1,6-bisphosphate aldolase | | Authors: | McNae, I.W., Dornan, J., Walkinshaw, M.D. | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9gv4 | | Status: | HPUB -- hold until publication | | Title: | TBA G-quadruplex binding nanobody (free form) | | Authors: | Pevec, M., Hadzi, S. | | Deposition date: | 2024-09-21 | | Sequence: | >Entity 1
QVQLQESGGGLVQAGGSLRLSCAASGSRFSSNTMTWYRQAPGKQREWVATMRSIGTTRYASSVEGRFTLSRDNAKNTVYLQMNSLKPEDTAVYYCNLRRGGGIYWGQGTQVTVSSHHHHHH
|
|
| PDBID: | 9jmt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9jmu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9jmr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PRV gB and FAB 16f9 complex | | Authors: | Li, Y., Zheng, Q., Li, S. | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9jms | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of VZV gB and FAB 16F9 complex | | Authors: | Li, Y., Zheng, Q., Li, S. | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9jmx | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-09-21 | | Release date: | 2025-09-21 |
|
| PDBID: | 9jmw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9jmv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9dpe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9dpd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SerRS dimer in complex with one SIRT2 | | Authors: | Yang, J., Zhang, Q., Lander, G.C., Yang, X. | | Deposition date: | 2024-09-21 |
|
