| PDBID: | 9h1o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of taxol-microtubules in complex with the C1 domain of GEFH1 | | Authors: | Choi, S.R., Blum, T., Steinmetz, M.O. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h1i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h1h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h1g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 | | Release date: | 2025-10-09 |
|
| PDBID: | 9h13 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9h0t | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin (1-131) in complex with a beta-fucosylamide side-product | | Authors: | Antonin, G., Varrot, A. | | Deposition date: | 2024-10-09 | | Sequence: | >Entity 1
GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9jve | | Status: | HPUB -- hold until publication | | Title: | Crysral structure of 2-keto-3-deoxypentonate 4-dehydrogenase from Herbaspirillum huttiense (apo form) | | Authors: | Watanabe, S., Akagashi, M. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvf | | Status: | HPUB -- hold until publication | | Title: | Structure of P450BytO in complex with pentapeptide MRYYH | | Authors: | Wang, H.Q., Xiang, Z. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvj | | Status: | HPUB -- hold until publication | | Title: | Structure of P450BytO mutant V219H in complex with pentapeptide MRYYH | | Authors: | Wang, H.Q., Xu, C., Ye, T., Xiang, Z. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jw1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | A protein complex | | Authors: | Takeda, H., Endo, T., Kikkawa, M., Akihisa, T. | | Deposition date: | 2024-10-09 | | Release date: | 2025-10-09 |
|
| PDBID: | 9jvk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PHBDD-M1-L163G with product N-ethyl-4-methylbenzamide | | Authors: | Yang, J. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvs | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of PHBDD-M1 with 4-formyl-N-methylbenzamide | | Authors: | Yang, J. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvl | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of PHBDD-M1-L163G-T234A with N-cyclopropyl-4-methylbenzamide | | Authors: | Yang, J., Gao, L., Qiu, X. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jw2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PHBDD | | Authors: | Yang, J. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvy | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of PHBDD-M1 with 1H-pyrrolo[2,3-b]pyridine-4-carbaldehyde | | Authors: | Yang, J., Qiu, X. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OsSPS3 complexed with YH24288 | | Authors: | Xiao, H., Li, M., Yang, G.-F. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jw6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-09 | | Release date: | 2025-10-09 |
|
| PDBID: | 9jw3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jw4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OsSPS3 complexed with YH24785 | | Authors: | Xiao, H., Li, M., Yang, G.-F. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvr | | Status: | HPUB -- hold until publication | | Title: | De novo designed GFP 1GFL-15 | | Authors: | Guo, Z., Liu, J.L., Lai, L.H. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9jvv | | Status: | HPUB -- hold until publication | | Title: | Overall structure of human EAAT2 in the substrate-free state | | Authors: | Xia, L.Y., Zhang, Y.Y., Shi, Y., Huang, J., Zhou, Q. | | Deposition date: | 2024-10-09 |
|
