PDBID: | 9lli | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-01-17 |
|
PDBID: | 9llj | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-17 |
|
PDBID: | 9llk | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-17 |
|
PDBID: | 9lkz | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-17 |
|
PDBID: | 9ll7 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-17 |
|
PDBID: | 9ll8 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-17 |
|
PDBID: | 9ll9 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-17 |
|
PDBID: | 9lla | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-17 |
|
PDBID: | 9llb | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-17 |
|
PDBID: | 9llu | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-17 |
|
PDBID: | 9ll6 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Ornithine decarboxylase H216F mutant without PLP | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | Deposition date: | 2025-01-17 |
|
PDBID: | 9llv | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-17 |
|
PDBID: | 9mvv | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-16 |
|
PDBID: | 9mvu | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-01-16 |
|
PDBID: | 9mvt | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-16 |
|
PDBID: | 9mw1 | Status: | HPUB -- hold until publication | Title: | Structure of SARM1 TIR domain bound to G8758 | Authors: | Wallweber, H.A., Sudhamsu, J. | Deposition date: | 2025-01-16 |
|
PDBID: | 9mvw | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-16 | Sequence: | >Entity 1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYIFAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
>Entity 2 (ACE)RRKWQKTGNAVRAIGRLSSM(NH2)
|
|
PDBID: | 9mvz | Status: | HPUB -- hold until publication | Title: | Tripartite complex of MmpL5-S5-AcpM from Mycolicibacterium smegmatis | Authors: | Zhang, Z., Maharjan, R., Gregor, W. | Deposition date: | 2025-01-16 |
|
PDBID: | 9mw5 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-16 |
|
PDBID: | 9mw2 | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-16 |
|
PDBID: | 9mw0 | Status: | HPUB -- hold until publication | Title: | Bipartite complex of MmpL5-AcpM from Mycolicibacterium smegmatis | Authors: | Zhang, Z., Maharjan, R., Gregor, W. | Deposition date: | 2025-01-16 |
|
PDBID: | 9mw3 | Status: | HPUB -- hold until publication | Title: | Structure of SARM1 TIR domain bound to G2756 | Authors: | Wallweber, H.A., Sudhamsu, J. | Deposition date: | 2025-01-16 |
|
PDBID: | 9mvx | Status: | PROC -- to be processed | Deposition date: | 2025-01-16 |
|
PDBID: | 9mw4 | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of feline coronavirus UU23 main protease with Pfizer intravenous compound PF-00835231 | Authors: | Shaqra, A.M., Maryam, A., Schiffer, C.A. | Deposition date: | 2025-01-16 |
|
PDBID: | 9i1c | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-16 |
|