PDBID: | 9bw5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvh | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvj | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvy | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-20 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bvw | Status: | HOLD -- hold until a certain date | Title: | SARS-CoV-2 main protease bound to inhibitor SR-B-103 | Authors: | Liu, W.R., Blankenship, L.R. | Deposition date: | 2024-05-20 | Release date: | 2025-05-20 |
|
PDBID: | 9bvx | Status: | HOLD -- hold until a certain date | Title: | SARS-CoV-2 main protease bound to inhibitor YR-C-155 | Authors: | Liu, W.R., Blankenship, L.R. | Deposition date: | 2024-05-20 | Release date: | 2025-05-20 |
|
PDBID: | 9bvz | Status: | HOLD -- hold until a certain date | Title: | SARS-CoV-2 main protease bound to inhibitor AR-A-135 | Authors: | Liu, W.R., Blankenship, L.R. | Deposition date: | 2024-05-20 | Release date: | 2025-05-20 |
|
PDBID: | 9bw2 | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Reduced Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-20 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bw3 | Status: | HPUB -- hold until publication | Title: | Consensus model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-20 |
|
PDBID: | 9bw4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bv7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvb | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 8zlf | Status: | HPUB -- hold until publication | Title: | Crystal structure of DH domain of FYVE Domain containing protein(FP10) from Entamoeba histolytica | Authors: | Gautam, A.K., Umarao, P., Gourinath, S. | Deposition date: | 2024-05-19 |
|
PDBID: | 9bv4 | Status: | HPUB -- hold until publication | Title: | NMR Solution Structure of Excelsatoxin A in DPC micelles | Authors: | Saipriyaa, P.V., Chin, Y.K., Mehdi, M. | Deposition date: | 2024-05-19 |
|
PDBID: | 9bv1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-19 |
|
PDBID: | 9bv2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-19 |
|
PDBID: | 9bv3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-19 |
|
PDBID: | 9fed | Status: | HPUB -- hold until publication | Title: | Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41 | Authors: | Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D. | Deposition date: | 2024-05-18 |
|
PDBID: | 8zlb | Status: | HPUB -- hold until publication | Title: | EB bound state of hPAC | Authors: | Su, N., Chen, X. | Deposition date: | 2024-05-18 |
|
PDBID: | 8zlc | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Ankyrin Repeat Protein from Plasmodium falciparum | Authors: | Kumari, P., Gautam, A.K., Gourinath, S., Malhotra, P. | Deposition date: | 2024-05-18 |
|
PDBID: | 9buz | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-18 |
|
PDBID: | 9fe2 | Status: | HPUB -- hold until publication | Title: | Crystallographic structure of AcrB V612W with bound minocycline | Authors: | Lazarova, M., Pos, K.M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fe3 | Status: | HPUB -- hold until publication | Title: | Crystallographic structure of AcrB V612W | Authors: | Lazarova, M., Pos, K.M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fe4 | Status: | HPUB -- hold until publication | Title: | Crystallographic structure of AcrB V612F | Authors: | Lazarova, M., Diederichs, K., Pos, K.M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdt | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor | Authors: | Friedrich, F., Einsle, O., Jung, M. | Deposition date: | 2024-05-17 |
|