| PDBID: | 9ckk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-09 |
|
| PDBID: | 9ckl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-09 |
|
| PDBID: | 9ckp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-09 |
|
| PDBID: | 9ckq | | Status: | HPUB -- hold until publication | | Title: | Human G protein-coupled receptor kinase 5-D311N ligand-free form | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-07-09 |
|
| PDBID: | 9cko | | Status: | HPUB -- hold until publication | | Title: | Human G protein-coupled receptor kinase 5 wild-type in complex with sangivamycin | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-07-09 |
|
| PDBID: | 9cks | | Status: | HPUB -- hold until publication | | Title: | Human G protein-coupled receptor kinase 5-D311N in complex with ATP and manganese ions | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-07-09 |
|
| PDBID: | 9ckr | | Status: | HPUB -- hold until publication | | Title: | Human G protein-coupled receptor kinase 5-D311N in complex with ATP and magnesium ion | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-07-09 |
|
| PDBID: | 9ckm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-09 |
|
| PDBID: | 9cki | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-09 |
|
| PDBID: | 9ckn | | Status: | HPUB -- hold until publication | | Title: | Histidine-covalent alpha-helical peptide (compound 6) targeting hMcl-1 | | Authors: | Muzzarelli, K.M., Assar, Z., Alboreggia, G., Pellecchia, M. | | Deposition date: | 2024-07-09 |
|
| PDBID: | 9ckt | | Status: | HPUB -- hold until publication | | Title: | X-ray diffraction structure of papain co-crystallized with E-64 | | Authors: | Vlahakis, N.W., Rodriguez, J.A. | | Deposition date: | 2024-07-09 |
|
| PDBID: | 9g0f | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of PmcTnsC-dsDNA-AMPPNP | | Authors: | Finocchio, G., Chanez, C., Querques, I., Speichert, K.J., Jinek, M. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0c | | Status: | HPUB -- hold until publication | | Title: | Structure of human Mical1 bMERB_V978A_V985A domain:Rab10 complex. | | Authors: | Rai, A., Goody, R.S. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0d | | Status: | HPUB -- hold until publication | | Title: | Structure of human Mical1 bMERB_V978A domain:Rab10 complex. | | Authors: | Rai, A., Goody, R.S. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0j | | Status: | HPUB -- hold until publication | | Title: | Structure of the PRO-PRO endopeptidase (PPEP-3) from Geobacillus thermodenitrificans | | Authors: | Claushuis, B., Wojtalla, F., van Leeuwen, H., Corver, J., Baumann, U., Hensbergen, P. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0g | | Status: | HPUB -- hold until publication | | Title: | BsCdaA in complex with Compound 7 | | Authors: | Neumann, P., Ficner, R. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0o | | Status: | HPUB -- hold until publication | | Title: | Xenopus borealis undecorated microtubule - 14 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0p | | Status: | HPUB -- hold until publication | | Title: | Xenopus laevis undecorated microtubule - 14 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0q | | Status: | HPUB -- hold until publication | | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0r | | Status: | HPUB -- hold until publication | | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 4-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0s | | Status: | HPUB -- hold until publication | | Title: | Xenopus tropicalis undecorated microtubule - 14 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0t | | Status: | HPUB -- hold until publication | | Title: | Xenopus tropicalis undecorated microtubule - 15 protofilament, 3-start helix | | Authors: | Troman, L.A., Moores, C.A. | | Deposition date: | 2024-07-08 |
|
| PDBID: | 9g0l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the RING-ZnF1 fragment of SIAH1 | | Authors: | Coste, F., Suskiewicz, M.J. | | Deposition date: | 2024-07-08 | | Sequence: | >Entity 1
MTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPLEHHHHHH
|
|
