| PDBID: | 9mk4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the VRC01-class antibody 12A01 derived from GT1.1 vaccination | | Authors: | Agrawal, S., Wilson, I.A. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9mk8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9mjr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9mjp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Neisseria meningitidis ClpP protease complex with boronate compound BC8a | | Authors: | Mabanglo, M.F., Houry, W.A. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9mk6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9mk9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9mk2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Neisseria meningitidis ClpP protease complex with noncovalent activator, ACP1-01 | | Authors: | Mabanglo, M.F., Houry, W.A. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9mk5 | | Status: | AUCO -- author corrections pending review | | Title: | Crystal structure of Neisseria meningitidis ClpP protease complex with small molecule activator, Dioctatin | | Authors: | Mabanglo, M.F., Houry, W.A. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9mk7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the WDR domain of WDR91 in complex with DR3634 | | Authors: | Zeng, H., Ahmad, H., Dong, A., Seitova, A., Owen, D., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9mjk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpz | | Status: | AUCO -- author corrections pending review | | Title: | Cryo-EM structure of the wild-type flagellar filament from Roseburia hominis | | Authors: | Bell, M.E.W., Koch, I., Hipp, K., Hartmann, M.D., Merino, F., Ley, R.E. | | Deposition date: | 2024-12-16 | | Release date: | 2025-12-16 |
|
| PDBID: | 9hq4 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hq6 | | Status: | HPUB -- hold until publication | | Title: | Structural insights in the HuHf@gold-monocarbene adduct: aurophilicity revealed in a biological context | | Authors: | Cosottini, L., Giachetti, A., Guerri, A., Martinez-Castillo, A., Geri, A., Zineddu, S., Abrescia, N.G.A., Messori, L., Turano, P., Rosato, A. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hq8 | | Status: | HPUB -- hold until publication | | Title: | Hypothetical protein from ssRNA Leviviricetes sp bacteriophage metagenome, IMGVR_UViG_3300036404_000292 | | Authors: | Balta, I., Sisovs, M., Tars, K. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of bovine TMEM206-YFP purified and plunged using MISO (micro-purification) | | Authors: | De Gieter, S., Eluru, G., Schenck, S., Stroobants, A., Efremov, R.G., Brunner, J.D. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of OXA-57 | | Authors: | Shaw, J.M., Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of mouse TMEM16F-YFP purified and plunged using MISO (microfluidic isolation) | | Authors: | De Gieter, S., Eluru, G., Schenck, S., Stroobants, A., Efremov, R.G., Brunner, J.D. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of meropenem bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of avibactam bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of bovine TMEM206 | | Authors: | Brunner, J.D., Schenck, S., De Gieter, S. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpq | | Status: | HPUB -- hold until publication | | Title: | Peptide-substrate-binding (PSB) domain of human type I collagen prolyl 4-hydroxylase complexed with Pro-Pro-Gly-Pro-Arg-Gly-Pro-Pro-Gly. | | Authors: | Sulu, R., Rahman, M.M., Wierenga, R.K., Koski, M.K. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hps | | Status: | HPUB -- hold until publication | | Title: | Human BclxLdeltaLT-VDAC1-N fusion protein complex structure | | Authors: | Janowski, R., Niessing, D. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hq0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqf | | Status: | HPUB -- hold until publication | | Title: | SARM1 TIR domain in complex with compound 7-ADPR | | Authors: | Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J. | | Deposition date: | 2024-12-16 | | Sequence: | >Entity 1
GGSSGSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQ
|
|
