PDBID: | 8ztz | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-06-07 | Release date: | 2025-06-07 |
|
PDBID: | 8zu2 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human Myt1 Kinase domain Bounded with compound 39 | Authors: | Zhang, Z.M., Zhou, Z.Q. | Deposition date: | 2024-06-07 |
|
PDBID: | 8ztx | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human Myt1 Kinase domain Bounded with compound 39 | Authors: | Zhang, Z.M., Zhou, Z.Q. | Deposition date: | 2024-06-07 |
|
PDBID: | 8zts | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 8ztu | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-07 |
|
PDBID: | 8ztt | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 8zth | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6l | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6m | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c69 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase, Cad1-CARF in the cA4 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c68 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase Cad1-CARF in the cA6 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c63 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c64 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c65 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 | Sequence: | >Entity 1 STLEVRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
|
|
PDBID: | 9c6o | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Multiple independent acquisitions of ACE2 usage in MERS-related coronaviruses | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Diseases, Veesler, D., Seattle Structural Genomics Center for Infectious Disease (SSGCID) | Deposition date: | 2024-06-07 |
|
PDBID: | 9c62 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6b | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c67 | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c66 | Status: | HPUB -- hold until publication | Title: | Structure of the Mena EVH1 domain bound to the polyproline segment of PTP1B | Authors: | LaComb, L., Fedorov, E., Bonanno, J.B., Almo, S.C., Ghosh, A. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6h | Status: | AUTH -- processed, waiting for author review and approval | Title: | [d3] Tensegrtiy triangle with deazapurine center strand (strand 3) in R3 | Authors: | Vecchioni, S., Sha, R., Ohayon, Y., Galindo, M., Lopez-Chamorro, C., Jong, M. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6i | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6c | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form with ATP (symmetric sites). | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6j | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6e | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6f | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form with ATP (Asymmetric sites). | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|