| PDBID: | 9dwc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of FABLE, PEG 600 condition | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwo | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of C4-Dicarboxylate-Binding Protein (PA0884) of Tripartite ATP-independent Periplasmic Transporter Family from Pseudomonas aeruginosa PAO1 in Complex with L-Malate | | Authors: | Minasov, G., Shukla, S., Shuvalova, L., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-10-09 | | Sequence: | >Entity 1
SNAAQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
| PDBID: | 9dwq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PKD2 ion channel, F629S variant | | Authors: | Esarte Palomero, O., DeCaen, P.G. | | Deposition date: | 2024-10-09 |
|
| PDBID: | 9dwp | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of C4-Dicarboxylate-Binding Protein (PA0884) of Tripartite ATP-independent Periplasmic Transporter Family from Pseudomonas aeruginosa PAO1 in Complex with Mesaconic Acid | | Authors: | Minasov, G., Shukla, S., Shuvalova, L., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-10-09 | | Sequence: | >Entity 1
SNAAQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
| PDBID: | 9h0f | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | SARS-CoV-2 Mpro in complex with a silicon-containing inhibitor | | Authors: | Andrews-Clark, T.C., Laczi, D., Schoenbauer, S., Brewitz, L., Schofield, C.J., Walsh, M. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fucosylated Lacto-N-biose binding protein from Bifidobacterium longum subsp. infantis in complex with Lacto-N-biose | | Authors: | Jensen, M., Hansen, M.E., Sakanaka, H., Slotboom, D.J., Abou Hachem, M., Morth, J.P. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fucosylated Lacto-N-biose binding protein from Bifidobacterium longum subsp. infantis in complex with Galacto-N-biose | | Authors: | Jensen, M., Hansen, M.E., Sakanaka, H., Slotboom, D.J., Abou Hachem, M., Morth, J.P. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of BiP ATPase domain in complex with CDNF C-terminal domain at 1.65 angstroms resolution | | Authors: | Fudo, S., Shpironok, O., Saarma, M., Kajander, T. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | N terminal domain of BC2L-C lectin in complex with N-(beta-L-Fucopyranosyl)-biphenyl-3-carboxamide | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0e | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human CREBBP histone acetyltransferase domain in complex with Propionyl- Coenzyme A | | Authors: | Mechaly, A.E., Cui, G., Green, M.R., Rodrigues-Lima, F. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-RAY CRYSTAL STRUCTURE OF THE CsPYL1-OPABACTIN-HAB1 TERNARY COMPLEX | | Authors: | Rivera-Moreno, M., Infantes, L., Albert, A. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-RAY CRYSTAL STRUCTURE OF THE CsPYL1-iCB-HAB1 TERNARY COMPLEX | | Authors: | Rivera-Moreno, M., Infantes, L., Albert, A. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-RAY CRYSTAL STRUCTURE OF THE CsPYL1 5M (V112L, T135L, F137I, T153I, V168A)-iCB-HAB1 TERNARY COMPLEX | | Authors: | Rivera-Moreno, M., Infantes, L., Albert, A. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9jv7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | De novo designed protein GFP-19 | | Authors: | Guo, Z., Liu, J.L., Lai, L.H. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9jv0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of P450BytO from Planomonospora sp. | | Authors: | Wang, H.Q., Xiang, Z. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9juj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-08 |
|
